Compile Data Set for Download or QSAR
maximum 50k data
Found 1 Enz. Inhib. hit(s) with Target = 'Cyclin-K' and Ligand = 'BDBM50270298'
TargetCyclin-K(Homo sapiens (Human))
China Pharmaceutical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  39nMAssay Description:Inhibition of human CDK9/Cyclin K using [protein fragment, 39 aa] as substrate preincubated for 20 mins followed by [gamma-33P]-ATP add...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed