Compile Data Set for Download or QSAR
maximum 50k data
Found 1 Enz. Inhib. hit(s) with Target = 'Cyclin-T1/Cyclin-dependent kinase 9' and Ligand = 'BDBM50570299'
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham

Curated by ChEMBL
LigandPNGBDBM50570299(CHEMBL4879020)
Affinity DataKi:  8nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed