Compile Data Set for Download or QSAR
maximum 50k data
Found 507 with Last Name = 'yu' and Initial = 'xh'
TargetDihydrofolate reductase(Homo sapiens (Human))
Zhengzhou University

Curated by ChEMBL
LigandPNGBDBM50457437(CHEBI:71223 | Folotyn | PDX | Pralatrexate)
Affinity DataKi:  0.0130nMAssay Description:Inhibition of DHFR (unknown origin) at pH 6.7More data for this Ligand-Target Pair
In DepthDetails PubMed
TargetCannabinoid receptor 2(Homo sapiens (Human))
Astrazeneca R&D Montreal

Curated by ChEMBL
LigandPNGBDBM50364921(CHEMBL1950329)
Affinity DataKi:  0.560nMAssay Description:Binding affinity to human CB2 receptorMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetThymidylate synthase(Homo sapiens (Human))
Zhengzhou University

Curated by ChEMBL
LigandPNGBDBM50027656(CHEBI:63616 | LY-2315 | LY-231514 | PEMETREXED | U...)
Affinity DataKi:  1.30nMAssay Description:Inhibition of thymidylate synthase (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361653(CHEMBL1940245)
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)
Affinity DataKi:  2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCannabinoid receptor 1(Homo sapiens (Human))
Astrazeneca R&D Montreal

Curated by ChEMBL
LigandPNGBDBM50364921(CHEMBL1950329)
Affinity DataKi:  3nMAssay Description:Displacement of [3H]-CP55,940 from human CB1 receptor expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50145214(2-(4-((methylamino)methyl)phenyl)-1H-benzo[d]imida...)
Affinity DataKi:  3.20nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50154756(6-(4-Methylaminomethyl-phenyl)-3,4-dihydro-2H-[1,4...)
Affinity DataKi:  3.80nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50122777(1-Phenyl-8,9-dihydro-7H-2,7,9a-triaza-benzo[cd]azu...)
Affinity DataKi:  4.10nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50122775(1-(4-Hydroxymethyl-phenyl)-8,9-dihydro-7H-2,7,9a-t...)
Affinity DataKi:  4.20nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50145216(2-(4-{[Bis-(2-hydroxy-ethyl)-amino]-methyl}-phenyl...)
Affinity DataKi:  4.5nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50145224(2-(4-Dimethylaminomethyl-phenyl)-1H-benzoimidazole...)
Affinity DataKi:  4.5nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50122781(1-Naphthalen-1-yl-8,9-dihydro-7H-2,7,9a-triaza-ben...)
Affinity DataKi:  4.90nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120707(2-Thiophen-2-yl-1,3,4,5-tetrahydro-azepino[5,4,3-c...)
Affinity DataKi:  5nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120704(2-Naphthalen-1-yl-1,3,4,5-tetrahydro-azepino[5,4,3...)
Affinity DataKi:  5nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120702(2-(4-Trifluoromethyl-phenyl)-1,3,4,5-tetrahydro-az...)
Affinity DataKi:  5nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM27685(2-{4-[(dimethylamino)methyl]phenyl}-3,10-diazatric...)
Affinity DataKi:  5nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50145223(2-(3-Dimethylaminomethyl-phenyl)-1H-benzoimidazole...)
Affinity DataKi:  5.60nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50122779(1-(4-Chloro-phenyl)-8,9-dihydro-7H-2,7,9a-triaza-b...)
Affinity DataKi:  5.70nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50122776(1-(4-Dimethylaminomethyl-phenyl)-8,9-dihydro-7H-2,...)
Affinity DataKi:  5.80nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50145221(2-{4-[(4-Methoxy-benzyl)-methyl-amino]-phenyl}-1H-...)
Affinity DataKi:  5.90nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50145225(2-(4-Pyrrolidin-1-ylmethyl-phenyl)-1H-benzoimidazo...)
Affinity DataKi:  5.90nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50154726(6-(4-Fluoro-phenyl)-1-oxo-1,2,3,4-tetrahydro-[1,4]...)
Affinity DataKi:  6nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120728(2-(4-Methoxy-phenyl)-1,3,4,5-tetrahydro-azepino[5,...)
Affinity DataKi:  6nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120724(2-Phenyl-1,3,4,5-tetrahydro-azepino[5,4,3-cd]indol...)
Affinity DataKi:  6nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120726(2-(3-Trifluoromethyl-phenyl)-1,3,4,5-tetrahydro-az...)
Affinity DataKi:  6nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120706(2-(4-Pyrrol-1-ylmethyl-phenyl)-1,3,4,5-tetrahydro-...)
Affinity DataKi:  6nMAssay Description:In vitro inhibitory activity of the compound towards human Poly (ADP-ribose) polymerase 1 (PARP-1)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50093374(2-(4-Hydroxy-phenyl)-1H-benzoimidazole-4-carboxyli...)
Affinity DataKi:  6nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50122772(1-(3-Dimethylaminomethyl-phenyl)-8,9-dihydro-7H-2,...)
Affinity DataKi:  6.30nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50154730(6-(4-((dimethylamino)methyl)phenyl)-3,4-dihydro-[1...)
Affinity DataKi:  6.40nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50154750(6-(4-Pyrrol-1-ylmethyl-phenyl)-3,4-dihydro-2H-[1,4...)
Affinity DataKi:  6.80nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50154728(6-(3-Methylaminomethyl-phenyl)-3,4-dihydro-2H-[1,4...)
Affinity DataKi:  6.90nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120721(1-Methyl-2-phenyl-1,3,4,5-tetrahydro-azepino[5,4,3...)
Affinity DataKi:  7nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120718(2-Pyridin-3-yl-1,3,4,5-tetrahydro-azepino[5,4,3-cd...)
Affinity DataKi:  7nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120710(2-(3-Amino-phenyl)-1,3,4,5-tetrahydro-azepino[5,4,...)
Affinity DataKi:  7nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50145219(2-(4-Piperidin-1-ylmethyl-phenyl)-1H-benzoimidazol...)
Affinity DataKi:  7.20nMAssay Description:Binding affinity towards human poly(ADP-ribose) polymerase-1 (PARP-1)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
Zhengzhou University

Curated by ChEMBL
LigandPNGBDBM50027656(CHEBI:63616 | LY-2315 | LY-231514 | PEMETREXED | U...)
Affinity DataKi:  7.20nMAssay Description:Inhibition of DHFR (unknown origin) assessed as inhibition constantMore data for this Ligand-Target Pair
In DepthDetails PubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50154739(6-(4-Chloro-phenyl)-1-oxo-1,2,3,4-tetrahydro-[1,4]...)
Affinity DataKi:  7.5nMAssay Description:Inhibition of human Poly (ADP-ribose) polymerase 1 enzymeMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50122774(1-(2-Chloro-phenyl)-8,9-dihydro-7H-2,7,9a-triaza-b...)
Affinity DataKi:  7.70nMAssay Description:Inhibitory activity of the compound against human full length Poly (ADP-ribose) polymerase 1More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120731(2-(1H-Pyrrol-2-yl)-1,3,4,5-tetrahydro-azepino[5,4,...)
Affinity DataKi:  8nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120723(2-(3-Dimethylaminomethyl-phenyl)-1,3,4,5-tetrahydr...)
Affinity DataKi:  8nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetPoly [ADP-ribose] polymerase 1(Homo sapiens (Human))
University Of Newcastle

Curated by ChEMBL
LigandPNGBDBM50120720(2-(2-Chloro-phenyl)-1,3,4,5-tetrahydro-azepino[5,4...)
Affinity DataKi:  8nMAssay Description:In vitro inhibitory activity towards human poly(ADP-ribose) polymerase 1 (PARP-1).More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 507 total ) | Next | Last >>
Jump to: