Search by Compound Name


Compound Name:

Compounds Sorted by Binding Data per Compound

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29
30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55
56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81
82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105
106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124
125 127 128 129 130 132 133 134 135 136 137 138 139 140 141 143 144 145 146
147 148 149 150 151 153 154 155 156 159 160 161 163 164 165 168 170 171 173
174 176 178 179 183 184 186 188 189 190 191 192 193 196 198 199 200 203 204
205 206 207 208 209 210 216 220 224 226 227 229 232 237 238 241 243 248 252
253 259 261 270 274 276 277 285 291 303 304 313 318 323 325 328 333 335 337
339 341 353 360 361 365 389 393 398 401 413 433 442 444 445 446 447 448 451
453 454 455 457 458 460 463 465 467 473 477 478 482 484 499 504 505 506 517
521 525 543 549 551 554 591 606 663 691 708 796 804 821 825 833 842 847 854
855 861 873 879 883 887 913 914 925 926 938 947 1010 1027 1050 1052 1081 1082
1099 1115 1130 1133 1206 1262 1543 1639 1903 2029
Compounds Sorted Alphabetically
Compound Name (alphabetical)
Enz. Inhib. Data
ITC Data
Binding Targets
Alternate Compound Names
23 Ki 17 IC50 1 Kd 1 EC50
  • HIV-1 Protease AE
  • HIV-1 Protease AE Mutant (V82F)
  • HIV-1 Protease AE-P
  • HIV-1 Protease AE-P Mutant (F82V)
  • HIV-1 Protease B Subtype
  • HIV-1 Protease B Subtype Mutant (V82F)
  • HIV-1 Protease Mutant M1 (L10I, G48V, I54V, L63P, V82A)
  • HIV-1 Protease Mutant M2 (D30N, L63P, N88D)
  • HIV-1 Protease Mutant M3 (L10I, L63P, A71V, G73S, I84V, L90M)
  • HIV-1 protease
  • Human immunodeficiency virus type 1 protease
  • Human immunodeficiency virus type 1 reverse transcriptase
  • P-glycoprotein 1
  • Protease
  • Replicase polyprotein 1ab
  • Solute carrier organic anion transporter family member 1B1 (OATP1B1)
  • Solute carrier organic anion transporter family member 1B3 (OATP1B3)
  • Solute carrier organic anion transporter family member 2B1
  • UDP-glucuronosyltransferase 1A1
  • Uridine-5'-diphosphoglucuronosyltransferase 1A1
  • Atazanavir
  • BMS 232632
  • CGP 73547
  • CHEMBL1163
  • Latazanavir
  • US10806794, Compound Atazanavir
  • methyl N-[(1S)-1-[[(2S,3S)-3-hydroxy-4-[[[(2S)-2-(methoxycarbonylamino)-3,3-dimethyl-butanoyl]amino]-[(4-pyridin-2-ylphenyl)methyl]amino]-1-phenyl-butan-2-yl]carbamoyl]-2,2-dimethyl-propyl]carbamate
  • methyl N-[(1S)-1-{[(2S,3S)-3-hydroxy-4-[(2S)-2-[(methoxycarbonyl)amino]-3,3-dimethyl-N'-{[4-(pyridin-2-yl)phenyl]methyl}butanehydrazido]-1-phenylbutan-2-yl]carbamoyl}-2,2-dimethylpropyl]carbamate
15 Ki 23 IC50 4 Kd
  • Axin-1/Glycogen synthase kinase-3 beta
  • CAMK2B
  • CaM-kinase kinase beta
  • Casein kinase I isoform alpha
  • Casein kinase II alpha (prime)
  • Casein kinase II subunit alpha
  • Myosin light chain kinase
  • Myosin light chain kinase, smooth muscle
  • PKA
  • Protein kinase C alpha type
  • Protein kinase Pfmrk
  • RAC-alpha serine/threonine-protein kinase
  • Rho-associated protein kinase 2
  • Rho-associated protein kinase 2 (ROCK II)
  • Ribosomal protein S6 kinase (P70S6K)
  • Ribosomal protein S6 kinase alpha 5
  • Serine/threonine-protein kinase AKT
  • Serine/threonine-protein kinase AKT2
  • cAMP-Dependent Protein Kinase (PKA)
  • cAMP-dependent protein kinase (PKA)
  • cGMP-dependent protein kinase
  • CHEMBL104264
  • H-89
  • H89
  • HT-89 (H-89)
  • N-(2-{[(2E)-3-(4-bromophenyl)prop-2-en-1-yl]amino}ethyl)isoquinoline-5-sulfonamide
  • N-[2-[[(E)-3-(4-bromophenyl)prop-2-enyl]amino]ethyl]isoquinoline-5-sulfonamide
40 IC50 2 Kd
  • Homo sapiens lysine demethylase 2A (KDM2A)
  • Lysine-specific demethylase 2B
  • Lysine-specific demethylase 3A
  • Lysine-specific demethylase 3B (KDM3B)
  • Lysine-specific demethylase 4A
  • Lysine-specific demethylase 4A (KDM4A)
  • Lysine-specific demethylase 4B
  • Lysine-specific demethylase 4C
  • Lysine-specific demethylase 5A
  • Lysine-specific demethylase 5A (KDM5A(aa 1-1090)-Flag)
  • Lysine-specific demethylase 5A (KDM5A(aa 1-588)ΔAP)
  • Lysine-specific demethylase 5A (KDM5A(aa 1-739)ΔAP(2C-2S))
  • Lysine-specific demethylase 5A (KDM5A)
  • Lysine-specific demethylase 5B
  • Lysine-specific demethylase 5B (KDM5B(aa 1-604)ΔAP)
  • Lysine-specific demethylase 5B (KDM5B(aa 1-755)ΔAP)
  • Lysine-specific demethylase 5C
  • Lysine-specific demethylase 5C (KDM5C(aa 1-789)ΔAP)
  • Lysine-specific demethylase 5C (KDM5C)
  • Lysine-specific demethylase 5D (KDM5D(aa 1-760)ΔAP)
  • Lysine-specific demethylase 5D (KDM5D)
  • Lysine-specific demethylase 6A
  • Lysine-specific demethylase 6B
  • 2-(((2-((2-(dimethylamino)ethyl)(ethyl)amino)-2-oxoethyl)amino)methyl)isonicotinic acid (KDM5-C49)
  • KDM5-C49
  • KDOAM-20
10 Ki 12 IC50 19 Kd 1 EC50
  • Adenosine receptor A2b
  • Bromodomain adjacent to zinc finger domain protein 2A
  • Bromodomain adjacent to zinc finger domain protein 2B
  • Bromodomain and PHD finger-containing protein 3
  • Bromodomain and WD repeat-containing protein 1
  • Bromodomain testis-specific protein
  • Bromodomain-containing protein 2
  • Bromodomain-containing protein 3
  • Bromodomain-containing protein 4
  • Bromodomain-containing protein 4 (BRD4)(aa 352-457)
  • Bromodomain-containing protein 4 (BRD4)(aa 57-168)
  • Bromodomain-containing protein 7
  • Bromodomain-containing protein 8
  • Bromodomain-containing protein 9
  • Cat eye syndrome critical region protein 2
  • E3 ubiquitin-protein ligase TRIM33
  • HIF1A/p300/CREB-binding protein
  • Histone acetyltransferase KAT2A/KAT2B
  • Histone acetyltransferase p300/Hypoxia-inducible factor 1-alpha
  • Peregrin
  • Protein polybromo-1
  • Transcription activator BRG1
  • Transcription initiation factor TFIID subunit 1-like
  • Transcription intermediary factor 1-alpha
  • Translocator protein
  • US10633379, Compound X
  • US9296741, 36
14 Ki 28 IC50
  • Angiopoietin-1 receptor
  • Aurora kinase A/Targeting protein for Xklp2
  • Aurora kinase B
  • Cyclin-Dependent Kinase 5 (CDK5)
  • Fibroblast growth factor receptor 1
  • Hepatocyte growth factor receptor
  • Insulin receptor
  • Insulin-like growth factor I receptor
  • Macrophage-stimulating protein receptor
  • Mast/stem cell growth factor receptor Kit
  • Mitogen-activated protein kinase 14
  • Mitogen-activated protein kinase 3
  • Mitogen-activated protein kinase 9
  • Proto-oncogene tyrosine-protein kinase Src
  • Proto-oncogene tyrosine-protein kinase receptor Ret
  • RAC-alpha serine/threonine-protein kinase
  • Ribosomal protein S6 kinase (P70S6K)
  • Ribosomal protein S6 kinase alpha 5
  • Serine/threonine-protein kinase AKT2
  • Serine/threonine-protein kinase pim-1
  • Serine/threonine-protein kinase pim-2
  • Tyrosine Kinase c-Met
  • Tyrosine Kinase c-Met Mutant (D1228H)
  • Tyrosine Kinase c-Met Mutant (H1094R)
  • Tyrosine Kinase c-Met Mutant (M1250T)
  • Tyrosine Kinase c-Met Mutant (V1092I)
  • Tyrosine Kinase c-Met Mutant (Y1230H)
  • Tyrosine-protein kinase ABL1
  • Tyrosine-protein kinase BTK
  • Tyrosine-protein kinase JAK1
  • Tyrosine-protein kinase JAK2
  • Tyrosine-protein kinase JAK3
  • Tyrosine-protein kinase Lck
  • Vascular endothelial growth factor receptor 2
  • cAMP-dependent protein kinase (PKA)
  • 1-(2-hydroxy-2-methylpropyl)-N-{5-[(7-methoxyquinolin-4-yl)oxy]pyridin-2-yl}-5-methyl-3-oxo-2-phenyl-2,3-dihydro-1H-pyrazole-4-carboxamide
  • Substituted Pyrazolone, 17
3 Ki 3 IC50 36 EC50
  • Bile salt export pump
  • Bile salt export pump (BSEP)
  • Intestinal fatty acid-binding protein (hIFABP)
  • Liver fatty acid binding protein (rat L-FABP)
  • Organic anion-transporting polypeptide 1D1 (Oatp1d1)
  • Peroxisome proliferator-activated receptor
  • Peroxisome proliferator-activated receptor alpha
  • Peroxisome proliferator-activated receptor alpha (PPAR alpha)
  • Peroxisome proliferator-activated receptor delta
  • Peroxisome proliferator-activated receptor gamma
  • 2-(4-{2-[(4-chlorophenyl)formamido]ethyl}phenoxy)-2-methylpropanoic acid
  • Azufibrat
  • Bezafibrate
  • CHEMBL264374
  • Cedur
  • Sklerofibrat
42 IC50
  • Cytochrome P450 1A
  • Cytochrome P450 2C8
  • Cytochrome P450 2C9
  • Cytochrome P450 2D6
  • Cytochrome P450 3A
  • P2X purinoceptor 2
  • P2X purinoceptor 3
  • P2X2/3
  • Trans Isomer 1; 3- (5-chloro-1,3- thiazol-2-yl)-5-{[3- hydroxybutan-2- yl]oxy}-N-{(1R)-1- [2-(trifluoromethyl) pyrimidin-5-yl]ethyl} benzamide
  • US10174016, Example 184
  • US10174016, Example 185
  • US10174016, Example 187
  • US10174016, Example 188
  • US10202369, Example 188
  • US10472354, Example 188
42 IC50
  • JAK1/TYK2
  • JAK2/JAK1
  • JAK2/TYK2
  • JAK3/JAK1
  • Non-receptor tyrosine-protein kinase TYK2
  • Tyrosine-protein kinase JAK1
  • Tyrosine-protein kinase JAK2
  • Tyrosine-protein kinase JAK3
  • Vascular endothelial growth factor receptor 2
  • US10463675, Example 7
  • US9663526, Example 7
1 Ki 40 IC50 1 Kd
  • Dual Specificity Protein Phosphatase 1
  • MKP-3
  • Purine nucleoside phosphorylase
  • Xanthine dehydrogenase
  • Xanthine dehydrogenase/oxidase
  • ALLOPURINOL
  • MLS000069453
  • SMR000059083
  • cid_2094
3 Ki 38 IC50 1 EC50
  • 10 kDa chaperonin
  • 60 kDa chaperonin
  • Bile salt export pump
  • Bile salt export pump (BSEP)
  • Botulinum neurotoxin type A
  • Canalicular multispecific organic anion transporter 1
  • Canalicular multispecific organic anion transporter 2
  • Epidermal growth factor receptor
  • Fibroblast growth factor receptor 1
  • HSP60/HSP10
  • Hepatitis C virus serine protease, NS3/NS4A
  • ITGAV/ITGB3
  • Multidrug resistance protein 1/Multidrug resistance associated protein 1
  • Multidrug resistance-associated protein 4
  • Nucleotide-binding oligomerization domain-containing protein 2
  • P-glycoprotein 1
  • P-gp nanodisc·BD-vinblastine
  • Proto-oncogene tyrosine-protein kinase Src
  • Reverse transcriptase
  • Serum paraoxonase/arylesterase 1
  • Solute carrier organic anion transporter family member 1B1 (OATP1B1)
  • Solute carrier organic anion transporter family member 1B3 (OATP1B3)
  • Thiosulfate sulfurtransferase
  • Tubulin beta chain
  • Tubulin beta-3 chain
  • Tyrosine-protein kinase ABL1
  • Tyrosine-protein kinase Mer
  • Uridine-5'-diphosphoglucuronosyltransferase 1A1
  • Uridine-5'-diphosphoglucuronosyltransferase 1A4
  • Uridine-5'-diphosphoglucuronosyltransferase 1A6
  • Uridine-5'-diphosphoglucuronosyltransferase 2B10
  • Uridine-5'-diphosphoglucuronosyltransferase 2B7
  • CHEMBL428647
  • PACLITAXEL
  • taxol
22 Ki 4 IC50 4 Kd 12 EC50
  • 5-hydroxytryptamine receptor 2A
  • Adenylate cyclase
  • Alpha-2C adrenergic receptor
  • D(1A) dopamine receptor
  • D(1B) dopamine receptor
  • D(2) dopamine receptor
  • D(3) dopamine receptor
  • Dopamine D1B
  • Dopamine receptor
  • POsterior Segregation family member (pos-1)
  • RecName: Full=Zinc finger protein mex-5
  • Replicase polyprotein 1ab
  • adrenergic Alpha2
  • (+/-)-SKF-38393
  • 1-Phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol
  • 1-Phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol (SK&F 38393)
  • 1-Phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol(SKF 38393)
  • 1-Phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol; hydrochloride(SKF 38393)
  • CHEMBL286080
  • CHEMBL505308
  • CHEMBL542700
  • RS(+/-)SKF 383931-Phenyl-2,3,4,5-tetrahydro-1H-benzo[d]azepine-7,8-diol
  • SK&F-38393
  • SK-38393
  • SKF 38393
  • SKF-38393
  • US9359372, SKF38393
  • cid_147514
20 Ki 22 IC50
  • 5-hydroxytryptamine receptor 2A
  • D(1A) dopamine receptor
  • D(2) dopamine receptor
  • D(3) dopamine receptor
  • D(4) dopamine receptor
  • Dopamine receptor
  • Muscarinic acetylcholine receptor
  • Muscarinic acetylcholine receptor M1
  • Serotonin 2 (5-HT2) receptor
  • Serotonin 3a (5-HT3a)/3b (5-HT3b) receptor
  • Serotonin receptor 2a and 2c (5HT2A and 5HT2C)
  • 2-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine
  • 2-Chloro-11-(4-methyl-piperazin-1-yl)-5H-dibenzo[b,e][1,4]diazepine(isoclozapine)
  • CHEMBL415300
  • ISOCLOZAPINE
32 Ki 9 IC50 1 EC50
  • NPFF
  • NPFF2
  • NPY2R
  • NPY5R
  • Neuropeptide Y
  • Neuropeptide Y receptor type 1
  • Neuropeptide Y receptor type 2
  • Neuropeptide Y receptor type 5 ( NPY Y5)
  • Neuropeptide Y receptor type 5 (NPY Y5)
  • PPYR1
  • CHEMBL438945
  • H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
  • NPY
  • NPY, human
  • NPY, human, rat
  • Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY)
  • human Neuropeptide Y
11 Ki 31 IC50
  • ALK tyrosine kinase receptor
  • ALK tyrosine kinase receptor (L1196M)
  • BDNF/NT-3 growth factors receptor
  • EML4-ALK
  • Focal adhesion kinase 1
  • High affinity nerve growth factor receptor
  • Leukocyte tyrosine kinase receptor
  • NT-3 growth factor receptor
  • PTK2B protein tyrosine kinase 2 beta (PTK2B)
  • Proto-oncogene tyrosine-protein kinase ROS
  • Tyrosine kinase non-receptor protein 2
  • Tyrosine-protein kinase FER
  • Tyrosine-protein kinase FRK
  • Tyrosine-protein kinase Fes/Fps
  • CHEMBL3286830
  • US10543199, Compound PF-06463922
  • US10780082, Compound PF-06463922
4 IC50 38 Kd
  • AP2-associated protein kinase 1
  • Aurora kinase A/Targeting protein for Xklp2
  • BMP-2-inducible protein kinase
  • CaM kinase I alpha
  • CaM kinase I delta
  • CaM kinase I gamma
  • CaM-kinase kinase beta
  • Casein kinase I
  • Casein kinase I isoform epsilon
  • Cyclin-dependent kinase 2
  • Death-associated protein kinase 2
  • Death-associated protein kinase 3
  • Dual specificity protein kinase CLK2
  • Dual specificity protein kinase CLK4
  • Dual specificity protein kinase TTK
  • Ephrin type-A receptor 3 (EPHA3)
  • MAP kinase-interacting serine/threonine-protein kinase 2
  • MAP/microtubule affinity-regulating kinase 2
  • Mitogen-activated protein kinase 10
  • Mitogen-activated protein kinase 12
  • Mitogen-activated protein kinase 8
  • Mitogen-activated protein kinase 9
  • Phosphorylase kinase
  • Ribosomal protein S6 kinase alpha 2
  • Ribosomal protein S6 kinase alpha 5
  • Serine/threonine-protein kinase 17A
  • Serine/threonine-protein kinase 2
  • Serine/threonine-protein kinase 38-like
  • Serine/threonine-protein kinase 4 (STK4)
  • Serine/threonine-protein kinase Aurora-C
  • Serine/threonine-protein kinase GAK
  • Serine/threonine-protein kinase MST2
  • Serine/threonine-protein kinase PCTAIRE-1
  • Serine/threonine-protein kinase PLK4
  • Serine/threonine-protein kinase pim-2
  • TRAF2 and NCK-interacting protein kinase (TNIK)
  • Tyrosine-protein kinase STK16 (STK16)
  • ULK3 kinase
  • SP-600125
42 IC50
  • Cyclooxygenase
  • Cyclooxygenase-1 (COX-1)
  • Prostaglandin E synthase/G/H synthase 2
  • Prostaglandin G/H synthase (cyclooxygenase)
  • 5-Bromo-2-(4-fluoro-phenyl)-3-(4-methanesulfonyl-phenyl)-thiophene
  • 5-bromo-2-(4-fluorophenyl)-3-(4-(methylsulfonyl)phenyl)thiophene
  • CHEMBL42485
  • DUP-697
17 Ki 23 IC50 2 Kd
  • 3-oxoacyl-acyl-carrier protein reductase
  • Acetylcholinesterase
  • Adenosine Receptors A2a (A2a)
  • Adenosine receptor A1
  • Adenosine receptor A2a
  • Adenosine receptor A3
  • Amine oxidase (flavin-containing) A
  • Amine oxidase [flavin-containing] B
  • Amyloid β-protein (Aβ42)
  • Aurora kinase B
  • Beta amyloid A4 protein
  • Carbonic anhydrase 1
  • Carbonic anhydrase 12
  • Carbonic anhydrase 2
  • Carbonic anhydrase 4
  • Carbonic anhydrase 7
  • Cholinesterases
  • Cytochrome P450 19A1
  • Cytochrome P450 1A
  • Cytochrome P450 1A1
  • Cytochrome P450 1B1
  • DNA Gyrase
  • Dihydroorotate dehydrogenase (fumarate)
  • Dipeptidyl peptidase III
  • Histone-lysine N-methyltransferase SETD7
  • P-glycoprotein (P-gp)
  • P-glycoprotein 1
  • Sarcoplasmic/endoplasmic reticulum calcium ATP-ase
  • TPA: Essential protein of the mitochondrial intermembrane space
  • Transient receptor protein 5 (TRPC5)
  • Tyrosinase
  • Tyrosine-protein kinase Lck
  • Tyrosine-protein kinase receptor FLT3
  • Xanthine dehydrogenase/oxidase
  • 3,5,7-Trihydroxyflavone
  • 3,5,7-triOH-flavone
  • 3,5,7-trihydroxy-2-phenyl-4H-benzopyran-4-one
  • 3,5,7-trihydroxy-2-phenyl-4H-chromen-4-one
  • CHEMBL309490
  • Galangin
  • Galangin (15)
  • Galangin (Gal)
  • cid_5281616
  • norizalpinin
28 Ki 10 IC50 4 Kd
  • Bile salt export pump
  • Cytochrome P450 1A
  • Cytochrome P450 2C19
  • Cytochrome P450 2C9
  • Cytochrome P450 2D6 (2D6)
  • Cytochrome P450 3A
  • Mu-type opioid receptor
  • Neurokinin 1 receptor
  • Neurokinin 2 receptor
  • Neurokinin 3 receptor
  • Neuromedin-K receptor
  • TACR3
  • (S)-(-)-N-(R-ethylbenzyl)-3-hydroxy-2-phenylquinoline-4-carboxamide
  • 3-Hydroxy-2-phenyl-quinoline-4-carboxylic acid ((S)-1-phenyl-propyl)-amide
  • 3-Hydroxy-2-phenyl-quinoline-4-carboxylic acid (1-phenyl-propyl)-amide
  • CHEMBL10188
  • SB 223412
  • SB-2234
  • SB-223412
  • Talnetant
18 Ki 14 IC50 10 EC50
  • 10 kDa chaperonin
  • 60 kDa chaperonin
  • Delta-type opioid receptor
  • HSP60/HSP10
  • Kappa-type opioid receptor
  • Mu-type opioid receptor
  • Thiosulfate sulfurtransferase
  • 17-cyclobutylmethyl-4,5alpha-epoxymorphinan-3,6alpha,14-triol
  • CHEMBL895
  • N-cyclobutylmethyl-4,5alpha-epoxy-3,6alpha,14-morphinantriol
  • NALBUPHINE
  • US10231963, Table B.1
  • US10512644, Compound Nalbuphine
  • US9233167, Nalbuphine
  • US9656961, Example 00118
38 IC50 4 EC50
  • 5'-AMP-activated protein kinase subunit beta-1
  • ALK1
  • ALK2
  • ALK3
  • ALK4
  • ALK5
  • AMP-activated protein kinase (AMPK)
  • Activin receptor type-1
  • Activin receptor type-1B
  • Activin receptor-like kinase 3 (ALK-3)
  • Bone morphogenetic protein
  • Bone morphogenetic protein 4
  • Bone morphogenetic protein receptor type-1B (BMPR1B) aa 168-495
  • Bone morphogenetic protein receptor type-2
  • Serine/threonine-protein kinase receptor R3
  • TGF-beta receptor type II
  • TGF-beta receptor type-1
  • Vascular endothelial growth factor receptor 2
  • 4-(6-(4-(piperazin-1-yl)phenyl)pyrazolo[1,5-a]pyrimidin-3-yl)quinoline
  • 4-[6-(4-piperazin-1-ylphenyl)pyrazolo[1,5-a]pyrimidin-3-yl]quinoline
  • CHEMBL513147
  • LDN-193189
42 Ki
  • α-Carbonic anhydrase (αCA)
  • β-Carbonic anhydrase (βCA)
  • Alpha-carbonic anhydrase
  • Astrosclerin-3
  • Beta-carbonic anhydrase
  • Carbonic Anhydrase XIII
  • Carbonic anhydrase
  • Carbonic anhydrase 1
  • Carbonic anhydrase 2
  • Carbonic anhydrase 4
  • Carbonic anhydrase 7
  • Gamma-carbonic anhydrase
  • CHEMBL471245
  • sodium trithiocarbonate
2 Ki 38 IC50 2 EC50
  • Human diphtheria toxin-like ADP-ribosyltransferase (ARTD3 or PARP3)
  • Poly [ADP-ribose] polymerase 1
  • Poly [ADP-ribose] polymerase 10
  • Poly [ADP-ribose] polymerase 12
  • Poly [ADP-ribose] polymerase 14
  • Poly [ADP-ribose] polymerase 15
  • Poly [ADP-ribose] polymerase 2
  • Poly [ADP-ribose] polymerase 4
  • Poly [ADP-ribose] polymerase tankyrase-1
  • Poly [ADP-ribose] polymerase tankyrase-2
  • Protein mono-ADP-ribosyltransferase PARP3
  • (S)-2-(4-(piperidin-3-yl)phenyl)-2H-indazole-7-carboxamide
  • CHEMBL1094636
  • MK-4827
  • Niraparib
42 IC50
  • Cytochrome P450 2C19
  • Cytochrome P450 2C9
  • Cytochrome P450 2D6 (2D6)
  • Cytochrome P450 3A
  • Monoamine transporter
  • Monoamine transporters; Norepinephrine & serotonin
  • Monoamine transporters; Norepininephrine & dopamine
  • Neuroepithelial cell-transforming 1
  • Neuroepithelial cell-transforming gene 1 protein
  • Potassium voltage-gated channel subfamily H member 2
  • Sodium-dependent dopamine transporter
  • Sodium-dependent noradrenaline transporter
  • Sodium-dependent serotonin transporter
  • (+/-)-1-(1-(3,4-dichlorophenyl)cyclohexyl)-N-methylethanamine
  • 1-(1-(3,4-dichlorophenyl)cyclohexyl)-N-methylethanamine
  • CHEMBL1684045
  • CHEMBL1684057
  • US10562878, Compound 108
9 IC50 33 Kd
  • ATPase family AAA domain-containing protein 2
  • Bromodomain adjacent to zinc finger domain protein 2A
  • Bromodomain adjacent to zinc finger domain protein 2B
  • Bromodomain and PHD finger-containing protein 3
  • Bromodomain and WD repeat-containing protein 1
  • Bromodomain testis-specific protein
  • Bromodomain-containing protein 1
  • Bromodomain-containing protein 2
  • Bromodomain-containing protein 3
  • Bromodomain-containing protein 4
  • Bromodomain-containing protein 7
  • Bromodomain-containing protein 8
  • Bromodomain-containing protein 9
  • CREB-binding protein
  • Cat eye syndrome critical region protein 2
  • E3 ubiquitin-protein ligase TRIM33
  • HIF1A/p300/CREB-binding protein
  • Histone acetyltransferase KAT2A/KAT2B
  • Nucleosome-remodeling factor subunit BPTF
  • Peregrin
  • Probable global transcription activator SNF2L2
  • Protein polybromo-1
  • Transcription activator BRG1
  • Transcription initiation factor TFIID subunit 1
  • Transcription initiation factor TFIID subunit 1-like
  • Transcription intermediary factor 1-alpha
  • CHEMBL4218735
42 Ki
  • 5-hydroxytryptamine receptor 1A
  • 5-hydroxytryptamine receptor 2A
  • 5-hydroxytryptamine receptor 2B
  • 5-hydroxytryptamine receptor 2C
  • 5-hydroxytryptamine receptor 3A
  • 5-hydroxytryptamine receptor 5A
  • 5-hydroxytryptamine receptor 6
  • 5-hydroxytryptamine receptor 7
  • Adrenergic receptor
  • Alpha-1A adrenergic receptor
  • Alpha-2A adrenergic receptor
  • Beta-1 adrenergic receptor
  • Beta-2 adrenergic receptor
  • Beta-2 adrenergic receptor and beta-3 adrenergic receptor
  • D(1A) dopamine receptor
  • D(1B) dopamine receptor
  • D(2) dopamine receptor
  • D(3) dopamine receptor
  • D(4) dopamine receptor
  • Delta-type opioid receptor
  • Histamine H1 receptor
  • Histamine H2 receptor
  • Histamine H3 receptor
  • Histamine receptor (H3 and H4)
  • Kappa-type opioid receptor
  • Monoamine transporter
  • Mu-type opioid receptor
  • Muscarinic acetylcholine receptor M1
  • Muscarinic acetylcholine receptor M1 and M3
  • Muscarinic acetylcholine receptor M2 and M4
  • Muscarinic acetylcholine receptor M2 and M5
  • Muscarinic acetylcholine receptor M5
  • Serotonin (5-HT) receptor
  • Sigma intracellular receptor 2
  • Sigma non-opioid intracellular receptor 1
  • Sodium-dependent dopamine transporter
  • CHEMBL4572167