BindingDB logo
myBDB logout

BindingDB Data by Sequence

Search BindingDB


This search will return sequences of biomolecules in BindingDB that are similar to your sequence of interest. Paste your protein or DNA search sequence into the textbox above, choose the appropriate desired search program from the pull-down menu above, and click the 'Search' button. Here are two protein sequences and one DNA sequence you can use to try this feature:

Sequence NameSource OrganismEnz. Inhib. DataITC DataSequence
α7β2 nAChR
Neuronal acetylcholine receptor protein alpha-2/beta-2 subunit
Neuronal acetylcholine receptor protein alpha-3/beta-2 subunit
Neuronal acetylcholine receptor protein alpha-4/beta-2 subunit
Neuronal acetylcholine receptor protein beta-2 subunit/protein beta-3 subunit/subunit alpha-3/subunit alpha-6
Nicotinic acetylcholine receptor alpha2/beta2
Nicotinic acetylcholine receptor alpha4/beta2/alpha5BDB
Homo sapiens
Homo sapiens (Human)
Homo sapiens (human)
β-Carbonic anhydrase (CA)
Carbonic anhydraseBDB
Saccharomyces cerevisiae
Saccharomyces cerevisiae (Baker's yeast)
β-Ketoacyl-acyl carrier protein (ACP) synthase III (FabH)
Beta-ketoacyl-ACP synthase III (FabH)BDB
11-beta-hydroxysteroid dehydrogenase 1BDBHomo sapiens (human)

11-beta-hydroxysteroid dehydrogenase 2BDBHomo sapiens (human)
15-hydroxyprostaglandin dehydrogenase [NAD+]BDBHomo sapiens (Human)
20S proteasome chymotrypsin-like
26S proteosomeBDB
Homo sapiens
Homo sapiens (Human)
26S proteosomeEBIHomo sapiens
Homo sapiens (Human)
26S proteosome
Proteasome component C5EBI
Homo sapiens
Homo sapiens (Human)
26S proteosome
Proteasome Macropain subunitEBI
Homo sapiens
Homo sapiens (Human)
26S proteosome
Proteasome subunit alpha type-6EBI
Homo sapiens
Homo sapiens (Human)
26S proteosome
Proteasome subunit beta type-10EBI
Homo sapiens
Homo sapiens (Human)
26S proteosome
Proteasome subunit beta type-7EBI
Homo sapiens
Homo sapiens (Human)
26S proteosome
Proteasome subunit beta type-9EBI
Homo sapiens
Homo sapiens (Human)
5'-AMP-activated protein kinase Complex 1
AMPK alpha1/beta2/gamma1BDB
Homo sapiens
Homo sapiens (Human)
5-HT1A/ 5-HT2c
Serotonin (5-HT) receptorBDB
Homo sapiens
Homo sapiens (Human)
Homo sapiens (human)
5-HT1A/ 5-HT2c
Serotonin (5-HT) receptor
Serotonin 2 (5-HT2) receptor
Serotonin receptor (2b and 2c)BDB
Homo sapiens
Homo sapiens (Human)
Homo sapiens (human)
5-hydroxytryptamine receptor 1B
Serotonin (5-HT) receptorBDB
Homo sapiens
Homo sapiens (Human)
Homo sapiens (human)
5-hydroxytryptamine receptor 1D
Serotonin (5-HT) receptorBDB
Homo sapiens
Homo sapiens (Human)
Homo sapiens (human)
5-hydroxytryptamine receptor 4 (5-HT4)
Serotonin (5-HT) receptorBDB
Homo sapiens
Homo sapiens (Human)
Homo sapiens (human)
5-Hydroxytryptamine receptor 6 (5-HT6)
Serotonin (5-HT) receptorBDB
Homo sapiens
Homo sapiens (Human)
Homo sapiens (human)
5-Hydroxytryptamine receptor 7 (5-HT7)
Serotonin (5-HT) receptorBDB
Homo sapiens
Homo sapiens (Human)
Homo sapiens (human)
Rattus norvegicus (rat)
5-Lipoxygenase/5-lipoxygenase activating protein
Homo sapiens (Human)
Homo sapiens (human)
Thiol:disulfide interchange protein (DsbA)BDB
Acetylcholine receptor protein alpha chain/beta chain/delta chain /gamma chainEBIHomo sapiens
Homo sapiens (Human)
Acetylcholine receptor protein alpha chain/beta chain/delta chain /gamma chain
Muscle-type nicotinic acetylcholine receptorEBI
Homo sapiens
Homo sapiens (Human)
Acetylcholine receptor protein alpha chain/beta chain/delta chain /gamma chain
Nicotinic acetylcholine receptor alpha2/beta2
Nicotinic acetylcholine receptor alpha2/beta4
alpha-1 Nicotinic AChRBDB
Homo sapiens
Homo sapiens (Human)
Acetylcholine receptor
Acetylcholine receptor protein alpha/beta/delta/gamma chainEBI
AcetylcholinesteraseBDBElectrophorus electricus (Electric eel)
Acetylcholinesterase (AChE)BDB
Homo sapiens (human)
Tetronarce californica (Pacific electric ray) (Torpedo californica)
Activator of S phase kinase DBF4/Cell division cycle 7-related protein kinase
Cdc7 KinaseBDB
Homo sapiens (Human)
Homo sapiens (human)
Activator of S phase kinase DBF4/Cell division cycle 7-related protein kinase
Cell division cycle 7-related protein kinaseBDB
Homo sapiens (Human)
Homo sapiens (human)
Acyl carrier protein, mitochondrial
Mitochondrial complex I; NADH oxidoreductaseEBI
Adenosine A2 receptorBDBHomo sapiens (human)
Rattus norvegicus (rat)
Adenosine A2 receptor
Adenosine receptor A2bBDB
Homo sapiens (Human)
Homo sapiens (human)
adrenergic Alpha1EBI
Adrenergic alpha1B
Adrenergic receptor alpha-1BDB
Homo sapiens (Human)
Adrenergic receptor alpha-1
Alpha-1A adrenergic receptorBDB
Homo sapiens (Human)
Adrenergic receptor alpha-2EBINEONATAL RAT
Rattus norvegicus (rat)
Adrenergic receptor alpha-2
adrenergic Alpha2EBI
Rattus norvegicus (rat)
Adrenergic receptor alpha-2
Alpha-2A adrenergic receptorBDB
Adrenergic receptor alpha-2
Alpha-2B adrenergic receptorBDB
Adrenergic receptor alpha-2
Alpha-2C adrenergic receptorBDB
Adrenergic receptor alpha
Adrenergic receptor alpha-1EBI
Homo sapiens (Human)
Adrenergic receptor alpha
Adrenergic receptor alpha-2BDB
Rattus norvegicus (rat)
Adrenergic receptor beta
Beta-1 adrenergic receptorBDB
Homo sapiens (Human)
Homo sapiens (human)
Adrenergic receptor beta
Beta-3 adrenergic receptorBDB
Homo sapiens (Human)
Homo sapiens (human)
Adrenomedullin receptor AM1, CALCRL/RAMP2EBIHomo sapiens
Homo sapiens (Human)
Adrenomedullin receptor AM1, CALCRL/RAMP2
Adrenomedullin receptor, AM2; CALCRL/RAMP3
Calcitonin gene-related peptide type 1 receptor
Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1BDB
Homo sapiens
Homo sapiens (Human)
Adrenomedullin receptor, AM2; CALCRL/RAMP3
Amylin receptor AMY3; CALCR/RAMP3EBI
Homo sapiens
Homo sapiens (Human)
Serine/threonine-protein kinase AKTBDB
ALK tyrosine kinase receptor/Nucleophosmin
Insulin receptor
Homo sapiens
Homo sapiens (Human)
Mus musculus
ALK tyrosine kinase receptor/Nucleophosmin
NPM/ALK (Nucleophosmin/ALK tyrosine kinase receptor)EBI
Homo sapiens
Homo sapiens (Human)
Alpha adrenergic receptor 1A and 1B
Alpha-1 Adrenergic Receptor/ adrenergic receptor/ adrenergic receptorBDB
Rattus norvegicus (Rat)
Rattus norvegicus (rat)
Alpha-1 Adrenergic Receptor/ adrenergic receptor/ adrenergic receptor
Alpha-1A adrenergic receptorBDB
Rattus norvegicus (Rat)
Rattus norvegicus (rat)
Alpha-1 Adrenergic Receptor/ adrenergic receptor/ adrenergic receptor
Alpha-1D adrenergic receptorBDB
Rattus norvegicus (Rat)
Rattus norvegicus (rat)
Alpha-galactosidase CEBIAspergillus niger
Coffea arabica
Alpha-galactosidase CEBI
Aspergillus niger
Coffea arabica
alpha-Glucosidase (α-Glucosidase)
alpha-Glucosidase (alpha-Glu)BDB
Saccharomyces cerevisiae
Saccharomyces cerevisiae (Baker's yeast)
Alpha-glucosidase MAL62EBIBacillus stearothermophilus
Saccharomyces cerevisiae
Alpha-glucosidase MAL62EBI
Bacillus stearothermophilus
Saccharomyces cerevisiae
ALX receptor and the G-protein Gα16
fMet-Leu-Phe receptor 1/2BDB
Homo sapiens (Human)
Homo sapiens (human)
ALX receptor and the G-protein Gα16
mGluR2 and G alpha 16BDB
Homo sapiens (Human)
Homo sapiens (human)
AMP deaminase 1EBIOryctolagus cuniculus11000000MNQKHLLRFIKKSYQVDADRVVYSTK
AMPK alpha1/beta2/gamma1
AMPK alpha2/beta2/gamma3EBI
Homo sapiens
Homo sapiens (Human)
AMPK alpha2/beta1/gamma1BDBHomo sapiens
Homo sapiens (Human)
Amylin receptor AMY1, CALCR/RAMP1
Amylin receptor AMY3; CALCR/RAMP3
Calcitonin receptorEBI
Amylin receptor AMY1, CALCR/RAMP1
Calcitonin gene-related peptide type 1 receptor/Receptor activity-modifying protein 1EBI
Homo sapiens
Homo sapiens (Human)
Amyloid β-protein (Aβ42)BDBHomo sapiens (Human)010000000MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLN
Angiotensin II receptorEBIHUMAN
Homo sapiens (Human)
Angiotensin II receptor
Angiotensin II type 1a (AT-1a)/1b (AT-1b) receptorBDB
Homo sapiens (Human)
Angiotensin-Converting Enzyme 2
Angiotensin-converting enzymeBDB
Antrax lethal toxin
Protective antigenEBI
Apoptosis regulator Bcl-2
GST-Bcl-2 ProteinBDB
Homo sapiens (Human)
Homo sapiens (human)
Apurinic-apyrimidinic endonuclease 1 (APE-1)BDBHomo sapiens (Human)

ATP synthase subunit gamma, mitochondrial
Mitochondrial complex V; ATP synthaseEBI
ATP-binding cassette sub-family G member 2BDBHomo sapiens (Human)

ATPase family AAA domain-containing protein 2EBIHomo sapiens

Aurora A/TPX2 (1-43)BDBHomo sapiens (Human)
Homo sapiens (human)
Aurora A/TPX2 (1-43)
Aurora kinase A/Targeting protein for Xklp2BDB
Homo sapiens (Human)
Homo sapiens (human)
Aurora B/Incenp
Aurora kinase A/BBDB
Axin-1/Glycogen synthase kinase-3 beta
Glycogen Synthase Kinase-3, beta
Glycogen synthase kinase-3BDB
Homo sapiens (human)
Rattus norvegicus (rat)
Bacterial DNA-directed RNA polymeraseEBIEscherichia coli
Escherichia coli K-12
Bacterial DNA-directed RNA polymerase
DNA-directed RNA polymerase subunit beta'EBI
Escherichia coli
Escherichia coli K-12
Bacterial DNA-directed RNA polymerase
RNA polymerase beta subunit (EC
RNA polymerase subunit beta (β-RNAP)BDB
Escherichia coli
Escherichia coli K-12
Bcr/Abl fusion protein
Breakpoint cluster region protein /Tyrosine-protein kinase ABLEBI
Homo sapiens
Homo sapiens (Human)
Beta amyloid A4 proteinBDBHomo sapiens (human)

Beta-amyloid protein 40BDBHomo sapiens (Human)012000000DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Beta-glucosidase AEBICaldocellum saccharolyticum
Prunus avium
Beta-glucosidase AEBI
Caldocellum saccharolyticum
Prunus avium
Beta-glucosidase cytosolicEBI
Beta-ketoacyl-ACP synthase (KasA)
Beta-ketoacyl-ACP synthase (KasA) C171QBDB
Beta-lactamase (SHV-1)
SHV-1 beta-lactamaseBDB
Escherichia coli
Klebsiella pneumoniae (Enterobacteria)
Beta-lactamase (TEM-1)
Beta-lactamase TEMBDB
Enterobacter cloacae
Escherichia coli
Beta-hexosaminidase subunit alpha (HexA)BDB
Beta-hexosaminidase subunit beta (Hex B)BDB
Beta-secretase (BACE)
Beta-secretase 1BDB
Beta-secretase (BACE)
Beta-secretase 2 (BACE2)BDB
Bile salt export pumpEBIRattus norvegicus
Bile salt export pump (BSEP)BDBHomo sapiens (Human)
Dual specificity mitogen-activated protein kinase kinase 1
Dual specificity mitogen-activated protein kinase kinase; MEK1/2BDB
Homo sapiens
Homo sapiens (human)
MAP kinase ERK2
Mitogen-activated protein kinase; ERK1/ERK2BDB
Homo sapiens (Human)
Homo sapiens (human)
RAF serine/threonine protein kinaseBDB
BRD4-BD1 and Histone H4
Bromodomain protein 4 (BRD4-BD1)BDB
BRD4-BD1 and Histone H4
Histone H4BDB
BRD4-BD1-BD2BDBHomo sapiens (Human)
Bromodomain-containing protein 4
Homo sapiens (Human)
Breakpoint cluster region protein /Tyrosine-protein kinase ABL
PI3K-alpha/ Abl
Tyrosine-protein kinase ABL
Tyrosine-protein kinase ABL1
mTOR/ Abl
p110-delta/ AblBDB
Homo sapiens
Homo sapiens (Human)
Homo sapiens (human)
Mus musculus
Bromodomain testis-specific proteinEBIHomo sapiens

Bromodomain-containing protein 2BDBHomo sapiens (Human)

Bromodomain-containing protein 3BDBHomo sapiens (Human)

C-C chemokine receptor type 3BDBHomo sapiens (Human)
Rattus norvegicus
C-X-C chemokine receptor type 3
CXCR3A / G protein (Galpha(16))BDB
Carbonic anhydrase
Carbonic anhydrase IBDB
Homo sapiens (Human)
Homo sapiens (human)
Carbonic Anhydrase III
Carbonic anhydraseBDB
Homo sapiens (Human)
Homo sapiens (human)
Carbonic anhydraseBDB
Homo sapiens (Human)
Homo sapiens (human)
Carbonic anhydrase
Carbonic anhydrase 13 (CA XIII)BDB
Homo sapiens (Human)
Homo sapiens (human)
Calcium channel
Voltage-gated L-type calcium channelEBI
Rattus norvegicus
CalmodulinEBIBos taurus
Homo sapiens
Calpain 1/small subunit 1EBIHomo sapiens
Homo sapiens (Human)
Calpain 1/small subunit 1
Homo sapiens
Homo sapiens (Human)
CaM kinase IIBDBHomo sapiens
Homo sapiens (Human)