BDBM50425005 CHEMBL2312188
SMILES CNc1nc(C)c(s1)-c1nc(Nc2cccc(O)c2)ncc1C#N
InChI Key InChIKey=NYRVLHGVDPPWJS-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 4 hits for monomerid = 50425005
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 11nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 11nMAssay Description:Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 12nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Oxford
Curated by ChEMBL
University Of Oxford
Curated by ChEMBL
Affinity DataKi: 12nMAssay Description:Inhibition of CDK2/Cyclin A (174 to 432 amino acid residues) (unknown origin) by differential scanning fluorimetry assayMore data for this Ligand-Target Pair