BDBM50591583 CHEMBL5169760
SMILES CN1CCN(Cc2ccc(Nc3ncc(Cl)c(Nc4ccccc4-c4n[nH]c(C)n4)n3)cc2)CC1
InChI Key InChIKey=RJTVPQLMBWIFKC-UHFFFAOYSA-N
Data 5 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 5 hits for monomerid = 50591583
Affinity DataIC50: 4nMAssay Description:Inhibition of human Aurora B using AKRRRLSSLRA as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 11nMAssay Description:Inhibition of human Axl using KKSRGDYMTMQIG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
Affinity DataIC50: 103nMAssay Description:Inhibition of human IGF-1R using KKKSPGEYVNIEFG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysi...More data for this Ligand-Target Pair
Affinity DataIC50: 130nMAssay Description:Inhibition of human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintil...More data for this Ligand-Target Pair
Affinity DataIC50: 500nMAssay Description:Inhibition of human ALK using KKKSPGEYVNIEFG as substrate incubated for 40 mins in the presence of [gamma33P]ATP by scintillation counting analysisMore data for this Ligand-Target Pair
