Cell Reactant:
HIV-1 Protease Mutant (L10I/L90M)
Syringe Reactant:
BDBM581
Meas. Tech.:
Isothermal Titration Calorimetry
Entry Date.:
05/10/04
ΔG°:
-34.276±n/a (kJ/mole)
pH:
5±n/a
Log10Kb:
5
Temperature:
298.15±n/a (K)
ΔH° :
35.948±0.836 (kJ/mole)
ΔHobs :
35.948±0.836 (kJ/mole)
Corrected for ΔHioniz:
not known
ΔS° :
0.2357±n/a (kJ/mole-K)
Citation
 Ohtaka, HSchön, AFreire, E Multidrug resistance to HIV-1 protease inhibition requires cooperative coupling between distal mutations. Biochemistry 42:13659-66 (2003) [PubMed]  Article
Cell React
Source:
The genes encoding HIV-1 protease mutants and wild type were expressed in E. coli.
Purity:
99%
Prep. Method:
HIV-1 protease was purified and refolded from E. coli inclusion bodies.
Name:
HIV-1 Protease Mutant (L10I/L90M)
Synonyms:
n/a
Type:
Protein Complex
Mol. Mass.:
n/a
Description:
n/a
Components:
This complex has 2 components.
Component 1
Name:
HIV-1 Protease Mutant (L10I/L90M) chain A
Synonyms:
HIV-1 Protease Mutant (L10I/L90M) chain B | HIV-1 Protease Mutant (Q7K/L33I/L63I/L10I/L90M)
Type:
Enzyme Subunit
Mol. Mass.:
10814.28
Organism:
Human immunodeficiency virus type 1
Description:
Mutations at selected positions (L10I/L90M) were introduced into HIV-1 protease pseudo wild type (Q7K/L33I/L63I)
Residue:
99
Sequence:
PQITLWKRPIVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF
  
Component 2
Name:
HIV-1 Protease Mutant (L10I/L90M) chain A
Synonyms:
HIV-1 Protease Mutant (L10I/L90M) chain B | HIV-1 Protease Mutant (Q7K/L33I/L63I/L10I/L90M)
Type:
Enzyme Subunit
Mol. Mass.:
10814.28
Organism:
Human immunodeficiency virus type 1
Description:
Mutations at selected positions (L10I/L90M) were introduced into HIV-1 protease pseudo wild type (Q7K/L33I/L63I)
Residue:
99
Sequence:
PQITLWKRPIVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEICGHKAIGTVLVGPTPVNIIGRNLMTQIGCTLNF
  
Syringe React
Source:
Bachem AG
Prep. Method:
Compound was prepared as a 7.8 mM stock solution in 9 mM NaOH.
Name:
BDBM581
Synonyms:
4-{2-[(3R)-4-[2-(2-acetamido-3-methylbutanamido)-3-methylbutanamido]-3-hydroxy-6-methylheptanamido]propanamido}-3-hydroxy-6-methylheptanoic acid | Acetyl Pepstatin
Type:
Small organic molecule
Emp. Form.:
n/a
Mol. Mass.:
n/a
SMILES:
n/a
Structure:
Search PDB for entries with ligand similarity: