Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholinesterase
LigandBDBM9058
Substrate/CompetitorBDBM8959
Meas. Tech.Enzyme Inhibition Assay
pH7.4±n/a
Temperature310.15±n/a K
IC50 1.9±0.2 nM
Citation Hu, MKWu, LJHsiao, GYen, MH Homodimeric tacrine congeners as acetylcholinesterase inhibitors. J Med Chem45:2277-82 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Acetylcholinesterase
Name:Acetylcholinesterase and butyrylcholinesterase (AChE and BChE)
Synonyms:AChE | Acetylcholinesterase (AChE) | Acetylcholinesterase precursor | Acetylcholinesterase, AChE
Type:Enzyme
Mol. Mass.:68193.62
Organism:Rattus norvegicus (rat)
Description:Enzyme was prepared from rat cortex homogenate.
Residue:614
Sequence:
MRPPWYPLHTPSLASPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPV
SAFLGIPFAEPPVGSRRFMPPEPKRPWSGILDATTFQNVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLIWIYGGGFYSGASSLDVYDGRFLAQVEGTVLVSM
NYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASV
GMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTEL
ISCLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPDALINTGDFQDLQVLVG
VVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPE
DPAHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGY
EIEFIFGLPLDPSLNYTVEERIFAQRLMQYWTNFARTGDPNDPRDSKSPRWPPYTTAAQQ
YVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQERCSDL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM9058
NameBDBM9058
Synonyms:Homodimeric Tacrine Analog 3m | N,N-Bis-(1,2,3,4-tetrahydro-cyclohexa[1,2,-b]pyrido-[2,3-b]pyrid-9-yl)-1,8-di-aminooctane | N-(8-{6H,7H,8H,9H-cyclohexa[b]1,8-naphthyridin-5-ylamino}octyl)-6H,7H,8H,9H-cyclohexa[b]1,8-naphthyridin-5-amine
TypeSmall organic molecule
Emp. Form.C32H40N6
Mol. Mass.508.7002
SMILESC(CCCCNc1c2CCCCc2nc2ncccc12)CCCNc1c2CCCCc2nc2ncccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM8959
NameBDBM8959
Synonyms:(2-Mercaptoethyl)trimethylammonium iodide acetate | ATC | Acetylthiocholine | [2-(acetylsulfanyl)ethyl]trimethylazanium iodide | acetylthiocholine chloride | acetylthiocholine iodide
TypeSmall organic molecule
Emp. Form.C7H16NOS
Mol. Mass.162.272
SMILESCC(=O)SCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: