Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma non-opioid intracellular receptor 1
LigandBDBM312233
Substrate/Competitorn/a
Meas. Tech.Receptor Assay
Ki 0.310±0.09 nM
Citation McCurdy, CRMesangeau, CChin, FTJames, MLShen, BGambhir, S Highly selective sigma receptor radioligands US Patent US9604926 Publication Date 3/28/2017
More Info.:Get all data from this article,  Assay Method
 
Sigma non-opioid intracellular receptor 1
Name:Sigma non-opioid intracellular receptor 1
Synonyms:Opioid receptor, sigma 1 | Oprs1 | Sigma 1-type opioid receptor | Sigma1-receptor | Sigma1R | Sigmar1
Type:Enzyme Catalytic Domain
Mol. Mass.:25246.51
Organism:Mus musculus (Mouse)
Description:O55242
Residue:223
Sequence:
MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYVLLFGTALGSHGHSGRY
WAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALEWGPNTWMVEYGRGVIPS
TLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM312233
NameBDBM312233
Synonyms:US9604926, Compound AZ-66 | US9724435, Compound AZ-66
TypeSmall organic molecule
Emp. Form.C22H32FN3OS
Mol. Mass.405.572
SMILESCC(CCCn1c2ccc(F)cc2sc1=O)N1CCN(CC1)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a