Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM13937
Substrate/CompetitorBDBM13790
Meas. Tech.Enzyme Assay and Determination of the Inhibition Constants
pH7.72±n/a
Temperature295.15±n/a K
Ki 3400±n/a nM
CommentspH where Ki is lowest (pH(min)), and Ki(min) toward bovine trypsin.
Citation Katz, BAElrod, KVerner, EMackman, RLLuong, CShrader, WDSendzik, MSpencer, JRSprengeler, PAKolesnikov, ATai, VWHui, HCBreitenbucher, JGAllen, DJanc, JW Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors. J Mol Biol329:93-120 (2003) [PubMed]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Trypsin
Name:Trypsin I
Synonyms:Beta-Trypsin | Cationic trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:25790.52
Organism:Bos taurus (bovine)
Description:P00760
Residue:246
Sequence:
MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13937
NameBDBM13937
Synonyms:2-(2-HYDROXY-PHENYL)-1H-BENZOIMIDAZOLE-5-CARBOXAMIDINE | APC-1144 | {amino[2-(2-hydroxyphenyl)-1H-1,3-benzodiazol-5-yl]methylidene}azanium
TypeSmall organic molecule
Emp. Form.C14H13N4O
Mol. Mass.253.2787
SMILESNC(=[NH2+])c1ccc2nc([nH]c2c1)-c1ccccc1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM13790
NameBDBM13790
Synonyms:6-amino-2-[(1-{2-[(4-methylbenzene)sulfonamido]acetyl}pyrrolidin-2-yl)formamido]-N-(4-nitrophenyl)hexanamide; acetic acid | Chromogenic Substrate | Chromozym-PL | Tosyl-Gly-Pro-Lys-pNA | Tosyl-glycyl-polyl-lysine-4-nitranilide-acetate | Trypsin/Thrombin Chromogenic Substrate | Trypsin/Thrombin/Plasmin Chromogenic Substrate | Trypsin/Thrombin/Tryptase Chromogenic Substrate
TypeSmall Organic Molecule
Emp. Form.C26H34N6O7S
Mol. Mass.574.649
SMILESCc1ccc(cc1)S(=O)(=O)NCC(=O)N1CCCC1C(=O)NC(CCCCN)C(=O)Nc1ccc(cc1)[N+]([O-])=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: