Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOrexin receptor type 2
LigandBDBM373502
Substrate/Competitorn/a
Meas. Tech.Cell-based Functional Assay
IC50>5000±n/a nM
Citation Kamenecka, TMHe, YNguyen, WJiang, RSong, XHerr, RJJiang, Q Substituted prolines/piperidines as orexin receptor antagonists US Patent US9896452 Publication Date 2/20/2018
More Info.:Get all data from this article,  Assay Method
 
Orexin receptor type 2
Name:Orexin receptor type 2
Synonyms:HCRTR2 | Hypocretin receptor type 2 | Orexin receptor type 2 (OR 2) | Orexin receptor type 2 (OR-2) | Orexin receptor type 2 (OX2) | Orexin receptor type 2 (OX2R) | Orexin receptor type 2 (OxR2) | Ox-2-R | Ox2-R
Type:Protein
Mol. Mass.:50710.53
Organism:Homo sapiens (Human)
Description:O43614
Residue:444
Sequence:
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAG
YIIVFVVALIGNVLVCVAVWKNHHMRTVTNYFIVNLSLADVLVTITCLPATLVVDITETW
FFGQSLCKVIPYLQTVSVSVSVLTLSCIALDRWYAICHPLMFKSTAKRARNSIVIIWIVS
CIIMIPQAIVMECSTVFPGLANKTTLFTVCDERWGGEIYPKMYHICFFLVTYMAPLCLMV
LAYLQIFRKLWCRQIPGTSSVVQRKWKPLQPVSQPRGPGQPTKSRMSAVAAEIKQIRARR
KTARMLMIVLLVFAICYLPISILNVLKRVFGMFAHTEDRETVYAWFTFSHWLVYANSAAN
PIIYNFLSGKFREEFKAAFSCCCLGVHHRQEDRLTRGRTSTESRKSLTTQISNFDNISKL
SEQVVLTSISTLPAANGAGPLQNW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM373502
NameBDBM373502
Synonyms:(S)-(4,4-difluoro-2-(((5-(trifluoromethyl)pyrimidin-2-yl)amino)methyl)piperidin-1-yl)(5-methyl-2-(pyrimidin-2-yl)phenyl)methanone | US9896452, Ex. A312
TypeSmall organic molecule
Emp. Form.C23H21F5N6O
Mol. Mass.492.4445
SMILESCc1ccc(-c2ncccn2)c(c1)C(=O)N1CCC(F)(F)CC1CNc1ncc(cn1)C(F)(F)F
Structure
n/a