Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetpoly-ADP-ribose polymerase 2 (PARP2)
LigandBDBM27506
Substrate/CompetitorBDBM27683
Meas. Tech.PARP Enzyme Inhibition Assay
Temperature298.15±n/a K
IC50 9810±n/a nM
Commentsextracted
Citation Ishida, JYamamoto, HKido, YKamijo, KMurano, KMiyake, HOhkubo, MKinoshita, TWarizaya, MIwashita, AMihara, KMatsuoka, NHattori, K Discovery of potent and selective PARP-1 and PARP-2 inhibitors: SBDD analysis via a combination of X-ray structural study and homology modeling. Bioorg Med Chem14:1378-90 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
poly-ADP-ribose polymerase 2 (PARP2)
Name:poly-ADP-ribose polymerase 2 (PARP2)
Synonyms:2.4.2.- | 2.4.2.30 | ADP-ribosyltransferase diphtheria toxin-like 2 | ADPRT-2 | ARTD2 | Adprt2 | Adprtl2 | Aspartl2 | DNA ADP-ribosyltransferase PARP2 | NAD(+) ADP-ribosyltransferase 2 | PARP-2 | Parp2 | Poly (ADP-ribose) Polymerase-2 (PARP-2) | Poly [ADP-ribose] polymerase 2 | Poly [ADP-ribose] polymerase 2 (Parp2) | Poly [ADP-ribose] polymerase-2 | Poly[ADP-ribose] synthase 2 | Poly[ADP-ribose] synthetase 2 | Protein poly-ADP-ribosyltransferase PARP2 | mPARP-2 | pADPRT-2
Type:n/a
Mol. Mass.:63409.97
Organism:Mus musculus (Mouse)
Description:Alexis Biochemicals, Cat. no. ALX-201-064-C020
Residue:559
Sequence:
MAPRRQRSGSGRRVLNEAKKVDNGNKATEDDSPPGKKMRTCQRKGPMAGGKDADRTKDNR
DSVKTLLLKGKAPVDPECAAKLGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDD
AQRNFSVWMRWGRVGKTGQHSLVTCSGDLNKAKEIFQKKFLDKTKNNWEDRENFEKVPGK
YDMLQMDYAASTQDESKTKEEETLKPESQLDLRVQELLKLICNVQTMEEMMIEMKYDTKR
APLGKLTVAQIKAGYQSLKKIEDCIRAGQHGRALVEACNEFYTRIPHDFGLSIPPVIRTE
KELSDKVKLLEALGDIEIALKLVKSERQGLEHPLDQHYRNLHCALRPLDHESNEFKVISQ
YLQSTHAPTHKDYTMTLLDVFEVEKEGEKEAFREDLPNRMLLWHGSRLSNWVGILSHGLR
VAPPEAPITGYMFGKGIYFADMSSKSANYCFASRLKNTGLLLLSEVALGQCNELLEANPK
AQGLLRGKHSTKGMGKMAPSPAHFITLNGSTVPLGPASDTGILNPEGYTLNYNEFIVYSP
NQVRMRYLLKIQFNFLQLW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27506
NameBDBM27506
Synonyms:3-AB | 3-aminobenzamide | CHEMBL81977
TypeSmall organic molecule
Emp. Form.C7H8N2O
Mol. Mass.136.1512
SMILESNC(=O)c1cccc(N)c1
Structure
BDBM27683
NameBDBM27683
Synonyms:[adenylate-32P]-NAD
Typeradiolabeled substrate
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure