BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase, tissue-nonspecific isozyme
LigandBDBM43805
Substrate/Competitorn/a
Meas. Tech.SAR assay for compounds activating TNAP in the presence of 100 mM DEA performed in a luminescence assay
EC50 10500±n/a nM
Citation PubChem, PC SAR assay for compounds activating TNAP in the presence of 100 mM DEA performed in a luminescence assay PubChem Bioassay(2009)[AID]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Alkaline phosphatase, tissue-nonspecific isozyme
Name:Alkaline phosphatase, tissue-nonspecific isozyme
Synonyms:tissue-nonspecific alkaline phosphatase precursor
Type:PROTEIN
Mol. Mass.:57306.17
Organism:Homo sapiens
Description:ChEMBL_1448917
Residue:524
Sequence:
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDE
KARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELN
RNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIG
QAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYV
PHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALALYPLSVLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM43805
NameBDBM43805
Synonyms:1-benzyl-3-(ethylcarbamothioylamino)thiourea | 1-benzyl-3-(ethylthiocarbamoylamino)thiourea | 1-ethyl-3-[(phenylmethyl)carbamothioylamino]thiourea | 1-ethyl-3-[[[(phenylmethyl)amino]-sulfanylidenemethyl]amino]thiourea | MLS-0232971.0002 | cid_1825238
TypeSmall organic molecule
Emp. Form.C11H16N4S2
Mol. Mass.268.402
SMILESCCNC(=S)NNC(=S)NCc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a