Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR4
LigandBDBM50097783
Substrate/Competitorn/a
Ki 0.002±n/a nM
CommentsPDSP_1765
Citation Raynor, KO'Carroll, AMKong, HYasuda, KMahan, LCBell, GIReisine, T Characterization of cloned somatostatin receptors SSTR4 and SSTR5. Mol Pharmacol44:385-92 (1993) [PubMed]
More Info.:Get all data from this article
 
SSTR4
Name:Somatostatin receptor
Synonyms:SOMATOSTATIN SST4 | Somatostatin receptor type 4
Type:Enzyme Catalytic Domain
Mol. Mass.:42096.84
Organism:RAT
Description:SOMATOSTATIN SST4 SSTR4 RAT::P30937
Residue:384
Sequence:
MNTPATLPLGGEDTTWTPGINASWAPDEEEDAVRSDGTGTAGMVTIQCIYALVCLVGLVG
NALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVLS
VDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAVF
ADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALR
AGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANS
CANPILYGFLSDNFRRSFQRVLCLRCCLLETTGGAEEEPLDYYATALKSRGGPGCICPPL
PCQQEPMQAEPACKRVPFTKTTTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097783
NameBDBM50097783
Synonyms:CHEMBL438401 | D-Trp8 SST-14 | SOMATOSTATIN | SRIF-D-Trp8
TypeSmall organic molecule
Emp. Form.C76H104N18O19S2
Mol. Mass.1637.878
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)[C@@H](CCCCN)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@@H](NC(=O)[C@@H](CO)NC1=O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N)C(C)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a