Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypanothione reductase
LigandBDBM50259708
Substrate/Competitorn/a
Meas. Tech.ChEBML_1691709
Ki 245000±n/a nM
Citation Arias, DGHerrera, FEGaray, ASRodrigues, DForastieri, PSLuna, LEBürgi, MDPrieto, CIglesias, AACravero, RMGuerrero, SA Rational design of nitrofuran derivatives: Synthesis and valuation as inhibitors of Trypanosoma cruzi trypanothione reductase. Eur J Med Chem125:1088-1097 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypanothione reductase
Name:Trypanothione reductase
Synonyms:N(1),N(8)-bis(glutathionyl)spermidine reductase | TR
Type:Homodimer; oxidoreductase
Mol. Mass.:53868.26
Organism:Trypanosoma cruzi
Description:n/a
Residue:492
Sequence:
MMSKIFDLVVIGAGSGGLEAAWNAATLYKKRVAVIDVQMVHGPPFFSALGGTCVNVGCVP
KKLMVTGAQYMEHLRESAGFGWEFDRTTLRAEWKKLIAVKDEAVLNINKSYEEMFRDTEG
LEFFLGWGSLESKNVVNVRESADPASAVKERLETENILLASGSWPHMPNIPGIEHCISSN
EAFYLPEPPRRVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGEMILRGFDHTLREELT
KQLTANGIQILTKENPAKVELNADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNA
GVMIKNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTNPRKTDHT
RVASAVFSIPPIGTCGLIEEVASKRYEVVAVYLSSFTPLMHNISGSKYKTFVAKIITNHS
DGTVLGVHLLGDNAPEIIQGVGICLKLNAKISDFYNTIGVHPTSAEELCSMRTPSYYYVK
GEKMEKPSEASL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50259708
NameBDBM50259708
Synonyms:BAY-2502 | BAY-A2502 | BAYER-2502 | CHEBI:7566 | DNDI1613515 | Lampit | NIFURTIMOX | Nifurtimox
TypeSmall organic molecule
Emp. Form.C10H13N3O5S
Mol. Mass.287.292
SMILESCC1CS(=O)(=O)CCN1\N=C\c1ccc(o1)[N+]([O-])=O
Structure
n/a