Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGABA transporter
LigandBDBM23183
Substrate/Competitorn/a
Meas. Tech.ChEMBL_177035
IC50 320000±n/a nM
Citation Krogsgaard-Larsen, PNielsen, LFalch, ECurtis, DR GABA agonists. Resolution, absolute stereochemistry, and enantioselectivity of (S)-(+)- and (R)-(-)-dihydromuscimol. J Med Chem28:1612-7 (1985) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GABA transporter
Name:GABA transporter
Synonyms:n/a
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of ChEMBL is 177939
Components:This complex has 4 components.
Component 1
Name:Sodium- and chloride-dependent GABA transporter 3
Synonyms:GAT-3 | Gabt3 | Gat-3 | Gat-b | Slc6a11 | Sodium- and chloride-dependent GABA transporter 3 | Solute carrier family 6 member 11
Type:PROTEIN
Mol. Mass.:69948.77
Organism:Rattus norvegicus
Description:ChEMBL_105007
Residue:627
Sequence:
MTAEQALPLGNGKAAEEARGSEALGGGGGGAAGTREARDKAVHERGHWNNKVEFVLSVAG
EIIGLGNVWRFPYLCYKNGGGAFLIPYVVFFICCGIPVFFLETALGQFTSEGGITCWRRV
CPLFEGIGYATQVIEAHLNVYYIIILAWAIFYLSNCFTTELPWATCGHEWNTEKCVEFQK
LNFSNYSHVSLQNATSPVMEFWERRVLAISDGIEHIGNLRWELALCLLAAWTICYFCIWK
GTKSTGKVVYVTATFPYIMLLILLIRGVTLPGASEGIKFYLYPDLSRLSDPQVWVDAGTQ
IFFSYAICLGCLTALGSYNNYNNNCYRDCIMLCCLNSGTSFVAGFAIFSVLGFMAYEQGV
PIAEVAESGPGLAFIAYPKAVTMMPLSPLWATLFFMMLIFLGLDSQFVCVESLVTAVVDM
YPKVFRRGYRRELLILALSIVSYFLGLVMLTEGGMYIFQLFDSYAASGMCLLFVAIFECV
CIGWVYGSNRFYDNIEDMIGYRPLSLIKWCWKVVTPGICAGIFIFFLVKYKPLKYNNVYT
YPAWGYGIGWLMALSSMLCIPLWIFIKLWKTEGTLPEKLQKLTVPSADLKMRGKLGASPR
MVTVNDCEAKVKGDGTISAITEKETHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:GABA transporter
Synonyms:GABA transporter 2
Type:PROTEIN
Mol. Mass.:68261.89
Organism:Rattus norvegicus
Description:ChEMBL_70051
Residue:602
Sequence:
MDNRVSGTTSNGETKPVCPVMEKVEEDGTLEREQWTNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLIFLFTCGIPVFFLETALGQYTNQGGITAWRKICPIFEGIGYASQM
IVSLLNVYYIVVLAWALFYLFSSFTTDLPWGSCSHEWNTENCVEFQKTNNSLNVTSENAT
SPVIEFWERRVLKISDGIQHLGSLRWELVLCLLLAWIICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNITRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCVALCILNSSTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRVFRKKNRREILI
LIVSVVSFFIGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGASRFYDNI
EDMIGYKPWPLIKYCWLFFTPAVCLATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMVCIPAWSIYKLRTLKGPLRERLRQLVCPAEDLPQKSQPELTSPATPMTSLLRLTELES
NC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 3
Name:GABA transporter 1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:67006.26
Organism:Rattus norvegicus
Description:ChEMBL_1472611
Residue:599
Sequence:
MATDNSKVADGQISTEVSEAPVASDKPKTLVVKVQKKAGDLPDRDTWKGRFDFLMSCVGY
AIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAP
MFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSLV
NTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWVLVYFCIWKGVGWTGKVV
YFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL
GSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASG
PGLAFLAYPEAVTQLPISPLWAILFFSMLLMLGIDSQFCTVEGFITALVDEYPRLLRNRR
ELFIAAVCIVSYLIGLSNITQGGIYVFKLFDYYSASGMSLLFLVFFECVSISWFYGVNRF
YDNIQEMVGSRPCIWWKLCWSFFTPIIVAGVFLFSAVQMTPLTMGSYVFPKWGQGVGWLM
ALSSMVLIPGYMAYMFLTLKGSLKQRLQVMIQPSEDIVRPENGPEQPQAGSSASKEAYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 4
Name:Sodium- and chloride-dependent betaine transporter
Synonyms:Na(+)/Cl(-) betaine/GABA transporter | Slc6a12 | Sodium- and chloride-dependent betaine transporter | Solute carrier family 6 member 12
Type:PROTEIN
Mol. Mass.:69749.57
Organism:Rattus norvegicus
Description:ChEMBL_105007
Residue:614
Sequence:
MDRKVTVHEDGCPVVSWVPEEGEMMDQKDKDQVKDRGQWTNKMEFVLSVAGEIIGLGNVW
RFPYLCYKNGGGAFFIPYFIFFFSCGIPVFFLEVALGQYSSQGSVTAWRKICPLLQGIGM
ASVVIESYLNIYYIIILAWALFYLFSSFTWELPWTTCTNSWNTEHCVDFLNYSSTRAASY
SENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWIICYFCIWKGVKSTGKVVY
FTATFPYLMLIILLIRGVTLPGAYQGIVFYLKPDLLRLKDPQVWMDAGTQIFFSFAICQG
CLTALGSYNKYHNNCYRDSIALCFLNSATSFVAGFVVFSILGFMAQEQGVPISEVAESGP
GLAFIAFPKAVTMMPLSQLWSCLFFLMLLFLGLDSQFVCMECLVTASMDMFPQQLRKRGR
RELLILAVAIVCYLMGLLLVTEGGMYIFQLFDYYASSGICLLFLSLFEVICIGWVYGADR
FYDNVEDMIGYRPWPLVKISWLFLTPGLCLATFFFSLSKYTPLKYNNVYIYPSWGYSIGW
LLAFSSMACVPLFIIITLLKTQGSFKKRLQRLITPDPSLPQPGRRSPQDGSSAQNCSTSP
VKQELIAWEKETHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23183
NameBDBM23183
Synonyms:5-(aminomethyl)-1,2-oxazol-3-ol | Agarin | CHEMBL273481 | Muscimol | Pantherine
TypeGABA Agonist
Emp. Form.C4H6N2O2
Mol. Mass.114.1026
SMILESNCc1cc(=O)[nH]o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a