Target
Neutrophil elastase
Ligand
BDBM50291942
Substrate
n/a
Meas. Tech.
ChEMBL_64660
KON
>2 M-1s-1
Citation
 Alpegiani, MBissolino, PCorigli, RDel Nero, SPerrone, ERizzo, VSacchi, NCassinelli, GFranceschi, GBaici, A Cephem sulfones as inactivators of human leukocyte elastase. 5. 7 alpha-Methoxy- and 7 alpha-chloro-1,1-dioxocephem 4-ketones. J Med Chem 37:4003-19 (1994) [PubMed]  Article
Target
Name:
Neutrophil elastase
Synonyms:
Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:
Enzyme
Mol. Mass.:
28532.38
Organism:
Homo sapiens (Human)
Description:
P08246
Residue:
267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
  
Inhibitor
Name:
BDBM50291942
Synonyms:
Benzoic acid (4S,7S)-2-(2,2-dimethyl-propionyl)-7-methoxy-3-(1-methyl-1H-tetrazol-5-ylsulfanylmethyl)-5,5,8-trioxo-5lambda*6*-thia-1-aza-bicyclo[4.2.0]oct-2-en-4-yl ester | CHEMBL128971
Type:
Small organic molecule
Emp. Form.:
C22H25N5O7S2
Mol. Mass.:
535.593
SMILES:
CO[C@@H]1C2N(C1=O)C(C(=O)C(C)(C)C)=C(CSc1nnnn1C)[C@@H](OC(=O)c1ccccc1)S2(=O)=O |t:14|
Structure:
Search PDB for entries with ligand similarity: