Target
Neuropeptide Y receptor type 5
Ligand
BDBM50089045
Substrate
n/a
Meas. Tech.
ChEBML_143988
IC50
44±n/a nM
Citation
 Rueeger, HRigollier, PYamaguchi, YSchmidlin, TSchilling, WCriscione, LWhitebread, SChiesi, MWalker, MWDhanoa, DIslam, IZhang, JGluchowski, C Design, synthesis and SAR of a series of 2-substituted 4-amino-quinazoline neuropeptide Y Y5 receptor antagonists. Bioorg Med Chem Lett 10:1175-9 (2000) [PubMed]  Article
Target
Name:
Neuropeptide Y receptor type 5
Synonyms:
NPY-Y5 | NPY-Y5 receptor | NPY5-R | NPY5R | NPYY5 | Neuropeptide Y receptor type 5 | Neuropeptide Y receptor type 5 ( NPY Y5) | Y5 receptor
Type:
Enzyme
Mol. Mass.:
50746.64
Organism:
Homo sapiens (Human)
Description:
Q15761
Residue:
445
Sequence:
MDLELDEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLGFMGNLLILMALMKKRNQKTTVNFLIGNLAFSDILVVLFCSPFTLTSVLLDQWMFGKVMCHIMPFLQCVSVLVSTLILISIAIVRYHMIKHPISNNLTANHGYFLIATVWTLGFAICSPLPVFHSLVELQETFGSALLSSRYLCVESWPSDSYRIAFTISLLLVQYILPLVCLTVSHTSVCRSISCGLSNKENRLEENEMINLTLHPSKKSGPQVKLSGSHKWSYSFIKKHRRRYSKKTACVLPAPERPSQENHSRILPENFGSVRSQLSSSSKFIPGVPTCFEIKPEENSDVHELRVKRSVTRIKKRSRSVFYRLTILILVFAVSWMPLHLFHVVTDFNDNLISNRHFKLVYCICHLLGMMSCCLNPILYGFLNNGIKADLVSLIHCLHM
  
Inhibitor
Name:
BDBM50089045
Synonyms:
CHEMBL17196 | Naphthalene-1-sulfonic acid [7-(4-amino-quinazolin-2-ylamino)-heptyl]-amide
Type:
Small organic molecule
Emp. Form.:
C25H29N5O2S
Mol. Mass.:
463.595
SMILES:
Nc1nc(NCCCCCCCNS(=O)(=O)c2cccc3ccccc23)nc2ccccc12
Structure:
Search PDB for entries with ligand similarity: