Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
LigandBDBM50120525
Substrate/Competitorn/a
Meas. Tech.ChEBML_89933
IC50 35±n/a nM
Citation Dhar, TGShen, ZFleener, CARouleau, KABarrish, JCHollenbaugh, DLIwanowicz, EJ The TosMIC approach to 3-(oxazol-5-yl) indoles: application to the synthesis of indole-based IMPDH inhibitors. Bioorg Med Chem Lett12:3305-8 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Inosine Monophosphate Dehydrogenase Type 2 (IMPDH2)
Name:Inosine-5'-monophosphate dehydrogenase (IMPDH)
Synonyms:IMP dehydrogenase 2 | IMPD 2 | IMPDH-II | Inosine 5'-monophosphate dehydrogenase II (IMPDH II) | Inosine-5 -monophosphate dehydrogenase 2 | Inosine-5''''-monophosphate dehydrogenase 2
Type:Enzyme
Mol. Mass.:55806.87
Organism:Homo sapiens (Human)
Description:Recombinant IMPDH2 expressed in E. coli.
Residue:514
Sequence:
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50120525
NameBDBM50120525
Synonyms:1-(3-Oxazol-5-yl-1H-indol-6-yl)-3-o-tolyl-urea | CHEMBL116061
TypeSmall organic molecule
Emp. Form.C19H16N4O2
Mol. Mass.332.3559
SMILESCc1ccccc1NC(=O)Nc1ccc2c(c[nH]c2c1)-c1cnco1
Structure
n/a