Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombin and coagulation factor X
LigandBDBM16303
Substrate/Competitorn/a
Meas. Tech.ChEMBL_334350
Ki 1±n/a nM
Citation Young, WBSprengeler, PShrader, WDLi, YRai, RVerner, EJenkins, TFatheree, PKolesnikov, AJanc, JWCregar, LElrod, KKatz, B Generation of potent coagulation protease inhibitors utilizing zinc-mediated chelation. Bioorg Med Chem Lett16:710-3 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thrombin and coagulation factor X
Name:Thrombin and coagulation factor X
Synonyms:Activation peptide fragment 1 | Activation peptide fragment 2 | Coagulation factor II | F2 | Prothrombin | Prothrombin precursor | Thrombin heavy chain | Thrombin light chain
Type:Protein
Mol. Mass.:70029.57
Organism:Homo sapiens (Human)
Description:P00734
Residue:622
Sequence:
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16303
NameBDBM16303
Synonyms:2-(1H-1,3-benzodiazol-2-ylmethyl)-1H-1,3-benzodiazole-6-carboximidamide | 2-(1H-benzimidazol-2-ylmethyl)-1H-benzimidazole-6-carboximidamide | APD-1 | CHEMBL46148
TypeSmall organic molecule
Emp. Form.C16H14N6
Mol. Mass.290.3226
SMILESNC(=N)c1ccc2nc(Cc3nc4ccccc4[nH]3)[nH]c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a