Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(1A) dopamine receptor
LigandBDBM50088341
Substrate/Competitorn/a
Meas. Tech.ChEMBL_417939
Ki 1.9±n/a nM
Citation Enzensperger, CLehmann, J Dopamine/serotonin receptor ligands. 13: Homologization of a benzindoloazecine-type dopamine receptor antagonist modulates the affinities for dopamine D(1)-D(5) receptors. J Med Chem49:6408-11 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(1A) dopamine receptor
Name:Dopamine D1 and D2 receptor
Synonyms:DA D1 receptor | DOPAMINE D1 | DRD1 | Dopamine D1 receptor | Dopamine D1 receptor (D1R) | Dopamine D1A
Type:Enzyme
Mol. Mass.:49303.43
Organism:Homo sapiens (Human)
Description:P21728
Residue:446
Sequence:
MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLA
ETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHAKN
CQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS
GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIET
VSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50088341
NameBDBM50088341
Synonyms:11-methyl-11,21-diazatetracyclo[12.7.0.0^{3,8}.0^{15,20}]henicosa-1(14),3(8),4,6,15,17,19-heptaene | 7-Methyl-6,7,8,9,14,15-hexahydro-5H-indolo[3,2-f][3]-benzazecine | 7-methyl-6,7,8,9,14,15-hexahydro-5H-benzo[7,8]azecino[5,4-b]indole(LE 300) | 7-methyl-6,7,8,9,14,15-hexahydro-5H-indolo[3,2-f][3]benzazecine | CHEMBL441618 | LE 300
TypeSmall organic molecule
Emp. Form.C20H22N2
Mol. Mass.290.4021
SMILESCN1CCc2c(Cc3ccccc3CC1)[nH]c1ccccc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a