Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50007522
Substrate/Competitorn/a
Meas. Tech.ChEMBL_491101
Ki 0.003±n/a nM
Citation Airaksinen, AJNag, SFinnema, SJMukherjee, JChattopadhyay, SGulyás, BFarde, LHalldin, C [11C]cyclopropyl-FLB 457: a PET radioligand for low densities of dopamine D2 receptors. Bioorg Med Chem16:6467-73 (2008) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:Dopamine receptor D2L/neurotensin receptor NTS1
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007522
NameBDBM50007522
Synonyms:5-Bromo-N-(1-ethyl-pyrrolidin-2-ylmethyl)-2,3-dimethoxy-benzamide | 5-bromo-N-((1-ethylpyrrolidin-2-yl)methyl)-2,3-dimethoxybenzamide | CHEMBL289330
TypeSmall organic molecule
Emp. Form.C16H23BrN2O3
Mol. Mass.371.269
SMILESCCN1CCC[C@H]1CNC(=O)c1cc(Br)cc(OC)c1OC |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a