Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLactoperoxidase
LigandBDBM50275895
Substrate/Competitorn/a
Meas. Tech.ChEMBL_493330
IC50 19600±n/a nM
Citation Das, DRoy, GMugesh, G Antithyroid drug carbimazole and its analogues: synthesis and inhibition of peroxidase-catalyzed iodination of L-tyrosine. J Med Chem51:7313-7 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lactoperoxidase
Name:Lactoperoxidase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:80305.60
Organism:Homo sapiens (Human)
Description:ChEMBL_493330
Residue:712
Sequence:
MRVLLHLPALLASLILLQAAASTTRAQTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAM
SSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLE
VGCGAPAPVVRCDPCSPYRTITGDCNNRRKPALGAANRALARWLPAEYEDGLSLPFGWTP
GKTRNGFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSE
YSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINAL
TSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTT
ARVPCFLAGDSRASEHILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAF
VQIITFRDYLPILLGDHMQKWIPPYQGYSESVDPRISNVFTFAFRFGHLEVPSSMFRLDE
NYQPWGPEPELPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMKQNKMMTGELRNKLFQ
PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGL
YGTPDNIDIWIGAIAEPLVERGRVGPLLACLLGKQFQQIRDGDRFWWENPGVFTNEQKDS
LQKMSFSRLVCDNTRITKVPRDPFWANSYPYDFVDCSAIDKLDLSPWASVKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50275895
NameBDBM50275895
Synonyms:CHEMBL469530 | methyl 3-ethyl-2-thioxo-2,3-dihydro-1H-imidazole-1-carboxylate
TypeSmall organic molecule
Emp. Form.C7H10N2O2S
Mol. Mass.186.232
SMILESCCn1ccn(C(=O)OC)c1=S
Structure
n/a