BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstanoid TP receptor
LigandBDBM50003776
Substrate/Competitorn/a
Meas. Tech.ChEBML_210264
IC50 18±n/a nM
Citation Vlattas, IDellureficio, JCohen, DSLee, WClarke, FDotson, RMathis, JZoganas, H Thia-prostanoid analogs with combined thromboxane receptor antagonist/thromboxane synthase inhibitor activities. Synthesis and pharmacological evaluation Bioorg Med Chem Lett4:2067-2072 (1994)    Article
More Info.:Get all data from this article,  Assay Method
 
Prostanoid TP receptor
Name:Thromboxane A2 receptor
Synonyms:TBXA2R | TXA2-R | Thromboxane | Thromboxane A2 receptor | Thromboxane Beta
Type:Enyzme
Mol. Mass.:37445.28
Organism:Homo sapiens (Human)
Description:P21731
Residue:343
Sequence:
MWPNGSSLGPCFRPTNITLEERRLIASPWFAASFCVVGLASNLLALSVLAGARQGGSHTR
SSFLTFLCGLVLTDFLGLLVTGTIVVSQHAALFEWHAVDPGCRLCRFMGVVMIFFGLSPL
LLGAAMASERYLGITRPFSRPAVASQRRAWATVGLVWAAALALGLLPLLGVGRYTVQYPG
SWCFLTLGAESGDVAFGLLFSMLGGLSVGLSFLLNTVSVATLCHVYHGQEAAQQRPRDSE
VEMMAQLLGIMVVASVCWLPLLVFIAQTVLRNPPAMSPAGQLSRTTEKELLIYLRVATWN
QILDPWVYILFRRAVLRRLQPRLSTRPRSLSLQPQLTQRSGLQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50003776
NameBDBM50003776
Synonyms:8-(4-Chloro-benzenesulfonylamino)-4-(3-pyridin-3-yl-propyl)-octanoic acid | CGS-22652 | CHEMBL65414
TypeSmall organic molecule
Emp. Form.C22H29ClN2O4S
Mol. Mass.452.995
SMILESOC(=O)CCC(CCCCNS(=O)(=O)c1ccc(Cl)cc1)CCCc1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a