Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTGF-beta receptor type I
LigandBDBM50304844
Substrate/Competitorn/a
Meas. Tech.ChEMBL_606316
Ki 952000±n/a nM
Citation Guckian, KCarter, MBLin, EYChoi, MSun, LBoriack-Sjodin, PAChuaqui, CLane, BCheung, KLing, LLee, WC Pyrazolone based TGFbetaR1 kinase inhibitors. Bioorg Med Chem Lett20:326-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
TGF-beta receptor type I
Name:TGF-beta receptor type I
Synonyms:2.7.11.30 | ALK-5 | ALK5 | ALK5 | ALK5/TGFBR1 | Activin A receptor type II-like protein kinase of 53kD | Activin receptor-like kinase 5 | Activin receptor-like kinase 5 (ALK-5) | Activin receptor-like kinase 5 (ALK5/TGFbeta) | P36897 | SKR4 | TGF-beta receptor type-1 | TGF-beta receptor type-1 (TGFR1) | TGFBR1 | Transforming Growth Factor
Type:n/a
Mol. Mass.:55968.24
Organism:Homo sapiens (Human)
Description:n/a
Residue:503
Sequence:
MEAAVAAPRPRLLLLVLAAAAAAAAALLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTE
TTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPG
LGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50304844
NameBDBM50304844
Synonyms:4-(2-aminophenyl)-1,2-dimethyl-5-(quinoxalin-6-yl)-1H-pyrazol-3(2H)-one | CHEMBL606695
TypeSmall organic molecule
Emp. Form.C19H17N5O
Mol. Mass.331.3712
SMILESCn1c(c(-c2ccccc2N)c(=O)n1C)-c1ccc2nccnc2c1 |(-.29,-47.9,;-.91,-46.49,;-2.42,-46.17,;-2.58,-44.64,;-3.92,-43.87,;-5.26,-44.64,;-6.59,-43.87,;-6.59,-42.33,;-5.26,-41.56,;-3.93,-42.32,;-2.6,-41.54,;-1.18,-44.01,;-.86,-42.51,;-.15,-45.16,;1.39,-44.99,;-3.74,-46.97,;-5.09,-46.22,;-6.41,-47.01,;-6.37,-48.55,;-7.69,-49.34,;-7.66,-50.88,;-6.31,-51.63,;-4.99,-50.83,;-5.02,-49.3,;-3.71,-48.5,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a