Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetButyrylcholinesterase
LigandBDBM50312888
Substrate/Competitorn/a
Meas. Tech.ChEMBL_615895
IC50 1400±n/a nM
Citation Takahashi, JHijikuro, IKihara, TMurugesh, MGFuse, STsumura, YAkaike, ANiidome, TTakahashi, TSugimoto, H Design, synthesis and evaluation of carbamate-modified (-)-N(1)-phenethylnorphysostigmine derivatives as selective butyrylcholinesterase inhibitors. Bioorg Med Chem Lett20:1721-3 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Butyrylcholinesterase
Name:Butyrylcholinesterase
Synonyms:Acylcholine acylhydrolase | Butyrylcholine esterase | Choline esterase II | Pseudocholinesterase
Type:Protein
Mol. Mass.:68465.99
Organism:Mus musculus (Mouse)
Description:Q03311
Residue:603
Sequence:
MQTQHTKVTQTHFLLWILLLCMPFGKSHTEEDFIITTKTGRVRGLSMPVLGGTVTAFLGI
PYAQPPLGSLRFKKPQPLNKWPDIHNATQYANSCYQNIDQAFPGFQGSEMWNPNTNLSED
CLYLNVWIPVPKPKNATVMVWIYGGGFQTGTSSLPVYDGKFLARVERVIVVSMNYRVGAL
GFLAFPGNPDAPGNMGLFDQQLALQWVQRNIAAFGGNPKSITIFGESAGAASVSLHLLCP
QSYPLFTRAILESGSSNAPWAVKHPEEARNRTLTLAKFTGCSKENEMEMIKCLRSKDPQE
ILRNERFVLPSDSILSINFGPTVDGDFLTDMPHTLLQLGKVKKAQILVGVNKDEGTAFLV
YGAPGFSKDNDSLITRKEFQEGLNMYFPGVSRLGKEAVLFYYVDWLGEQSPEVYRDALDD
VIGDYNIICPALEFTKKFAELENNAFFYFFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLG
RRVNYTRAEEIFSRSIMKTWANFAKYGHPNGTQGNSTMWPVFTSTEQKYLTLNTEKSKIY
SKLRAPQCQFWRLFFPKVLEMTGDIDETEQEWKAGFHRWSNYMMDWQNQFNDYTSKKESC
TAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50312888
NameBDBM50312888
Synonyms:3alpha,8-dimethyl-1-phenethyl-1,2,3,3alpha,8,8alpha-hexahydropyrrolo[2,3-b]indol-5-yl4-(hexyloxy)phenylcarbamate | CHEMBL1081457
TypeSmall organic molecule
Emp. Form.C33H41N3O3
Mol. Mass.527.6969
SMILESCCCCCCOc1ccc(NC(=O)Oc2ccc3N(C)[C@H]4N(CCc5ccccc5)CC[C@@]4(C)c3c2)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a