Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine kinase
LigandBDBM50316799
Substrate/Competitorn/a
Meas. Tech.ChEMBL_629062
Ki 26800±n/a nM
Citation Kim, YARawal, RKYoo, JSharon, AJha, AKChu, CKRais, RHAl Safarjalani, ONNaguib, FNEl Kouni, MH Structure-activity relationships of carbocyclic 6-benzylthioinosine analogues as subversive substrates of Toxoplasma gondii adenosine kinase. Bioorg Med Chem18:3403-12 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine kinase
Name:Adenosine kinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:38353.04
Organism:Toxoplasma gondii
Description:ChEMBL_629062
Residue:363
Sequence:
MAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQ
FNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAP
GQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNALE
VAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAE
KTALSTANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTVVVHEV
GVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTS
LPC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50316799
NameBDBM50316799
Synonyms:(1'R,2'S,3'R,4'R)-1-[2,3-Dihydroxy-4-(hydroxymethyl)-cyclopentan-1-yl]-6-(3-methylbenzyl-thio)purine | CHEMBL1094555
TypeSmall organic molecule
Emp. Form.C19H22N4O3S
Mol. Mass.386.468
SMILESCc1cccc(CSc2ncnc3n(cnc23)[C@@H]2C[C@H](CO)[C@@H](O)[C@H]2O)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a