Target
Carbonic anhydrase 6
Ligand
BDBM26981
Substrate
n/a
Meas. Tech.
ChEMBL_700657
Ki
810000±n/a nM
Citation
 Bertucci, AInnocenti, AScozzafava, ATambutté, SZoccola, DSupuran, CT Carbonic anhydrase inhibitors. Inhibition studies with anions and sulfonamides of a new cytosolic enzyme from the scleractinian coral Stylophora pistillata. Bioorg Med Chem Lett 21:710-4 (2011) [PubMed]  Article
Target
Name:
Carbonic anhydrase 6
Synonyms:
CA-VI | Carbonate dehydratase VI | Carbonic Anhydrase VI | Carbonic anhydrase | Carbonic anhydrase 6 | Carbonic anhydrase 6 (CA VI) | Carbonic anhydrase 6 (CA-VI) | Carbonic anhydrase VI (CA VI) | Salivary carbonic anhydrase | Secreted carbonic anhydrase
Type:
Enzyme
Mol. Mass.:
35371.40
Organism:
Homo sapiens (Human)
Description:
P23280
Residue:
308
Sequence:
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEILDYLRRALN
  
Inhibitor
Name:
BDBM26981
Synonyms:
CHEMBL1644695 | I- | IODIDE | POTASSIUM IODIDE | iodide | iodide ion
Type:
Ion
Emp. Form.:
I
Mol. Mass.:
126.90502
SMILES:
[I-]
Structure:
Search PDB for entries with ligand similarity: