Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMu-type opioid receptor
LigandBDBM50336676
Substrate/Competitorn/a
Meas. Tech.ChEMBL_722917
Ki 0.243±n/a nM
Citation Nemoto, TYamamoto, NWatanabe, AFujii, HHasebe, KNakajima, MMochizuki, HNagase, H Synthesis of 6,14-epoxymorphinan derivatives and their pharmacologies. Bioorg Med Chem19:1205-21 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mu-type opioid receptor
Name:Mu-type opioid receptor
Synonyms:M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1
Type:Enzyme Catalytic Domain
Mol. Mass.:11165.58
Organism:GUINEA PIG
Description:P97266
Residue:98
Sequence:
YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336676
NameBDBM50336676
Synonyms:CHEMBL1672483 | N-[(6beta,14beta-Epoxy-3-hydroxy-17-phenethylmorphinan-6alpa-yl)methyl]benzamide
TypeSmall organic molecule
Emp. Form.C32H34N2O3
Mol. Mass.494.624
SMILESOc1ccc2C[C@H]3N(CCc4ccccc4)CC[C@@]4(C[C@]5(CNC(=O)c6ccccc6)CC[C@@]34O5)c2c1 |r,THB:8:7:33:35.4.5|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a