Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase
LigandBDBM50009832
Substrate/Competitorn/a
Meas. Tech.ChEMBL_32097
IC50 0.84±n/a nM
Citation Mylari, BLBeyer, TASiegel, TW A highly specific aldose reductase inhibitor, ethyl 1-benzyl-3-hydroxy-2(5H)-oxopyrrole-4-carboxylate, and its congeners. J Med Chem34:1011-8 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase
Name:Aldose reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35797.87
Organism:Rattus norvegicus
Description:ChEMBL_1512484
Residue:316
Sequence:
MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009832
NameBDBM50009832
Synonyms:1-Benzyl-4-hydroxy-5-oxo-2,5-dihydro-1H-pyrrole-3-carboxylic acid ethyl ester | CHEMBL269550
TypeSmall organic molecule
Emp. Form.C14H15NO4
Mol. Mass.261.2732
SMILESCCOC(=O)C1CN(Cc2ccccc2)C(=O)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a