Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADRA1B
LigandBDBM50122813
Substrate/Competitorn/a
Meas. Tech.ChEMBL_34197
Ki 0.690±n/a nM
Citation Balle, TPerregaard, JRamirez, MTLarsen, AKSøby, KKLiljefors, TAndersen, K Synthesis and structure-affinity relationship investigations of 5-heteroaryl-substituted analogues of the antipsychotic sertindole. A new class of highly selective alpha(1) adrenoceptor antagonists. J Med Chem46:265-83 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ADRA1B
Name:ADRA1B
Synonyms:Adrenergic receptor alpha | Alpha-1b adrenergic receptor | adrenergic Alpha1B
Type:Enzyme Catalytic Domain
Mol. Mass.:56514.13
Organism:C.H.O.
Description:adrenergic Alpha1B ADRA1B C.H.O.::P18841
Residue:515
Sequence:
MNPDLDTGHNTSAPAQWGELKDANFTGPNQTSSNSTLPQLDVTRAISVGLVLGAFILFAI
VGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLGYWVLGRIFCDI
WAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGP
LLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAG
VMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVV
GMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFM
RILGCQCRSGRRRRRRRRLGACAYTYRPWTRGGSLERSQSRKDSLDDSGSCMSGSQRTLP
SASPSPGYLGRGAQPPLELCAYPEWKSGALLSLPEPPGRRGRLDSGPLFTFKLLGEPESP
GTEGDASNGGCDATTDLANGQPGFKSNMPLAPGHF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122813
NameBDBM50122813
Synonyms:3-(2-{4-[1-(4-Fluoro-phenyl)-5-(2-methyl-2H-tetrazol-5-yl)-1H-indol-3-yl]-piperidin-1-yl}-ethyl)-oxazolidin-2-one | CHEMBL97242
TypeSmall organic molecule
Emp. Form.C26H28FN7O2
Mol. Mass.489.5446
SMILESCn1nnc(n1)-c1ccc2n(cc(C3CCN(CCN4CCOC4=O)CC3)c2c1)-c1ccc(F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a