Target
Carbonic anhydrase 5A, mitochondrial
Ligand
BDBM26981
Substrate
n/a
Meas. Tech.
ChEMBL_700697
Ki
25000000±n/a nM
Citation
 Ekinci, DCeyhun, SBSentürk, MErdem, DKüfrevioglu, OISupuran, CT Characterization and anions inhibition studies of ana-carbonic anhydrase from the teleost fish Dicentrarchus labrax. Bioorg Med Chem 19:744-8 (2011) [PubMed]  Article
Target
Name:
Carbonic anhydrase 5A, mitochondrial
Synonyms:
CA-VA | Carbonate dehydratase VA | Carbonic Anhydrase VA | Carbonic anhydrase 5A (CA VA) | Carbonic anhydrase 5A, mitochondrial | Carbonic anhydrase 5A, mitochondrial precursor | Carbonic anhydrase V | Carbonic anhydrase VA (CA VA)
Type:
Enzyme
Mol. Mass.:
34755.54
Organism:
Homo sapiens (Human)
Description:
Human (cloned) isozyme
Residue:
305
Sequence:
MLGRNTWKTSAFSFLVEQMWAPLWSRSMRPGRWCSQRSCAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS
  
Inhibitor
Name:
BDBM26981
Synonyms:
CHEMBL1644695 | I- | IODIDE | POTASSIUM IODIDE | iodide | iodide ion
Type:
Ion
Emp. Form.:
I
Mol. Mass.:
126.90502
SMILES:
[I-]
Structure:
Search PDB for entries with ligand similarity: