Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl carrier protein, mitochondrial
LigandBDBM50411090
Substrate/Competitorn/a
Meas. Tech.ChEMBL_373476
IC50 870±n/a nM
Citation Ichimaru, NAbe, MMurai, MSenoh, MNishioka, TMiyoshi, H Function of the alkyl side chains of Deltalac-acetogenins in the inhibitory effect on mitochondrial complex I (NADH-ubiquinone oxidoreductase). Bioorg Med Chem Lett16:3555-8 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl carrier protein, mitochondrial
Name:Acyl carrier protein, mitochondrial
Synonyms:ACP | CI-SDAP | NADH-ubiquinone oxidoreductase 9.6 kDa subunit | NDUFAB1
Type:PROTEIN
Mol. Mass.:17397.64
Organism:Bos taurus
Description:ChEMBL_469770
Residue:156
Sequence:
MAVRVLCACVRRLPTAFAPLPRLPTLAAARPLSTTLFAAETRTRPGAPLPALVLAQVPGR
VTQLCRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50411090
NameBDBM50411090
Synonyms:CHEMBL211345
TypeSmall organic molecule
Emp. Form.C30H58O4
Mol. Mass.482.7791
SMILESCCCCC(CC)CCC[C@@H](O)[C@H]1CC[C@@H](O1)[C@H]1CC[C@@H](O1)[C@H](O)CCCC(CC)CCCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a