Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(2) dopamine receptor
LigandBDBM50183266
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1586241
Ki 0.027000±n/a nM
Citation Etukala, JRZhu, XYEyunni, SVOnyameh, EKOfori, EBricker, BAKang, HJHuang, XPRoth, BLAblordeppey, SY Development of CNS multi-receptor ligands: Modification of known D2 pharmacophores. Bioorg Med Chem24:3671-9 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(2) dopamine receptor
Name:Dopamine receptor D2L/neurotensin receptor NTS1
Synonyms:DOPAMINE D2 | DOPAMINE D2 Long | DOPAMINE D2 Short | DRD2 | Dopamine D2 receptor | Dopamine D2 receptor (D2) | Dopamine D2 receptor (D2R) | Dopamine D2A | Dopamine2-like
Type:Cell-surface receptors
Mol. Mass.:50647.10
Organism:Homo sapiens (Human)
Description:P14416
Residue:443
Sequence:
MDPLNLSWYDDDLERQNWSRPFNGSDGKADRPHYNYYATLLTLLIAVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGLNNADQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRAHLRAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKILHC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50183266
NameBDBM50183266
Synonyms:Anquil | BENPERIDOL | Benperidol | Benquil | MCN-JR-4584 | R-4584
TypeSmall organic molecule
Emp. Form.C22H24FN3O2
Mol. Mass.381.4433
SMILESOc1nc2ccccc2n1C1CCN(CCCC(=O)c2ccc(F)cc2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a