Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I delta/epsilon
LigandBDBM274628
Substrate/Competitorn/a
Meas. Tech.Kinase Assay
pH7.4±n/a
Temperature298.15±n/a K
IC50 9.84±n/a nM
Commentsextracted
Citation Velaparthi, UDarne, CPDodd, DSSampognaro, AJWittman, MDKumaravel, SMullick, DLiu, PRachamreddy, CR Substituted imidazoles as casein kinase 1 D/E inhibitors US Patent US9556179 Publication Date 1/31/2017
More Info.:Get all data from this article,  Assay Method
 
Casein kinase I delta/epsilon
Name:Casein kinase I delta/epsilon
Synonyms:CKI-delta | CKId | CSNK1D | Casein kinase 1 delta (CK1δ) | Casein kinase I delta | Casein kinase I isoform delta (CK1D) | casein kinases 1 delta (CK1 delta)
Type:Enzyme
Mol. Mass.:47356.76
Organism:Homo sapiens (Human)
Description:P48730
Residue:415
Sequence:
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNISSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM274628
NameBDBM274628
Synonyms:6-(tert-butyl)-N-(6-(2-(4- fluorophenyl)imidazo[1,2-a] pyridin-3-yl)imidazo[1,2-b] pyridazin-2-yl)pyrimidine- 4-carboxamide | US9556179, Compound 202
TypeSmall organic molecule
Emp. Form.C28H23FN8O
Mol. Mass.506.5336
SMILESCC(C)(C)c1cc(ncn1)C(=O)Nc1cn2nc(ccc2n1)-c1c(nc2ccccn12)-c1ccc(F)cc1
Structure
n/a