Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEpstein-Barr virus protease (EBV Pr)
LigandBDBM130376
Substrate/Competitorn/a
Meas. Tech.Nuclear Magnetic Resonance (NMR) Assay
pH8±n/a
IC50 4.0e+3± 1e+2 nM
Commentsextracted
Citation Gable, JELee, GMJaishankar, PHearn, BRWaddling, CARenslo, ARCraik, CS Broad-spectrum allosteric inhibition of herpesvirus proteases. Biochemistry53:4648-60 (2014) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Epstein-Barr virus protease (EBV Pr)
Name:EBNA-1 protein
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:56444.81
Organism:Human herpesvirus 4
Description:gi_23893623
Residue:641
Sequence:
MSDEGPGTGPGNGLGEKGDTSGPEGSGGSGPQRRGGDNHGRGRGRGRGRGGGRPGAPGGS
GSGPRHRDGVRRPQKRPSCIGCKGTHGGTGAGAGAGGAGAGGAGAGGGAGAGGGAGGAGG
AGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGG
AGGAGAGGGAGGAGGAGAGGGAGAGGAGGAGGAGAGGAGAGGGAGGAGGAGAGGAGAGGA
GAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGGAGAGGGAGGAGAGGAGGAGAGGA
GGAGAGGAGGAGAGGGAGAGGAGAGGGGRGRGGSGGRGRGGSGGRGRGGSGGRRGRGRER
ARGGSRERARGRGRGRGEKRPRSPSSQSSSSGSPPRRPPPGRRPFFHPVGEADYFEYHQE
GGPDGEPDVPPGAIEQGPADDPGEGPSTGPRGQGDGGRRKKGGWFGKHRGQGGSNPKFEN
IAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTALAIPQCRLTPLSRLP
FGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSF
DDGVDLPPWFPPMVEGAAAEGDDGDDGDEGGDGDEGEEGQE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM130376
NameBDBM130376
Synonyms:N-[2-Benzyl-4-(1H-1,2,3,4-tetrazol-5-yl)phenyl]-6-(cyclohexylmethyl)pyridine-2- carboxamide (2)
TypeSmall organic molecule
Emp. Form.C27H28N6O
Mol. Mass.452.5508
SMILESO=C(Nc1ccc(cc1Cc1ccccc1)-c1nnn[nH]1)c1cccc(CC2CCCCC2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a