Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase receptor TIE-2
LigandBDBM239619
Substrate/Competitorn/a
Meas. Tech.Time-Resolved Fluorescence Resonance Energy Transfer (TR-FRET) Assay
pH7±n/a
Temperature295.15±n/a K
IC50 350±n/a nM
Commentsextracted
Citation Süβmeier, FLobell, MGrünewald, SHärter, MBuchmann, BTelser, JJöriβen, HHeroult, MKahnert, ALustig, KLindner, N Substituted phenylimidazopyrazoles and their use US Patent US9394309 Publication Date 7/19/2016
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase receptor TIE-2
Name:Tyrosine-protein kinase receptor TIE-2
Synonyms:n/a
Type:Enzyme
Mol. Mass.:39865.58
Organism:Homo sapiens (Human)
Description:amino acids 776-1124
Residue:349
Sequence:
NVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNF
GQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHR
GYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSQQLLHFAADVARGMDYL
SQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVY
TTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCW
REKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM239619
NameBDBM239619
Synonyms:US9394309, 72
TypeSmall organic molecule
Emp. Form.C24H18F5N5O2S
Mol. Mass.535.489
SMILESCOc1ccc(NC(=O)c2cccc(c2)S(F)(F)(F)(F)F)cc1-n1ccn2nc(cc12)-c1cccnc1
Structure
n/a