Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma intracellular receptor 2
LigandBDBM497392
Substrate/Competitorn/a
Ki 435±n/a nM
Citation Godek, DMHoward, HRStewart, AM Cycloalkyl-diamines for the treatment of pain US Patent US11007200 Publication Date 5/18/2021
More Info.:Get all data from this article,  Assay Method
 
Sigma intracellular receptor 2
Name:Sigma intracellular receptor 2
Synonyms:MAC30 | Meningioma-associated protein 30 | S2R | Sigma-2 receptor | Sigma2 receptor | TMEM97 | Transmembrane protein 97
Type:Protein
Mol. Mass.:20857.20
Organism:Homo sapiens (Human)
Description:Q5BJF2
Residue:176
Sequence:
MGAPATRRCVEWLLGLYFLSHIPITLFMDLQAVLPRELYPVEFRNLLKWYAKEFKDPLLQ
EPPAWFKSFLFCELVFQLPFFPIATYAFLKGSCKWIRTPAIIYSVHTMTTLIPILSTFLF
EDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM497392
NameBDBM497392
Synonyms:US11007200, Example 13b
TypeSmall organic molecule
Emp. Form.C21H35ClN4
Mol. Mass.378.982
SMILESCN[C@]1(CCCC[C@@H]1NCCCN1CCN(C)CC1)c1ccccc1Cl
Structure
n/a