Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFragile X mental retardation syndrome-related protein 1
LigandBDBM504304
Substrate/Competitorn/a
Meas. Tech.AlphaScreen Assay
EC50 140±20 nM
Citation Pellicciari, RGioiello, A Farnesoid X receptor modulators US Patent US11034717 Publication Date 6/15/2021
More Info.:Get all data from this article,  Assay Method
 
Fragile X mental retardation syndrome-related protein 1
Name:Fragile X mental retardation syndrome-related protein 1
Synonyms:n/a
Type:Protein
Mol. Mass.:63945.20
Organism:Rat
Description:Q5XI81
Residue:568
Sequence:
MAELTVEVRGSNGAFYKVFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEIS
EGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKT
VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKR
VNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSN
IQQARKVPGVTAIELDEDTGTFRIYGESAEAVKKARGFLEFVEDFIQVPRNLVGKVIGKN
GKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKE
VEQLRMERLQIDEQLRQIGMGFRPSSTRGPEKEKGYATDESTVSSVQGSRSYSGRGRGRR
GPNYTSGYGTNSELSNPSETESERKDELSDWSLAGEDDRETRHQRDSRRRPGGRGRSVSG
GRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRRRRSRRRRT
DEDAVLMDGMTESDTASVNENGLGKRCD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM504304
NameBDBM504304
Synonyms:3α,7α,11β-rihydroxy-6α-ethyl-5β-cholan-24-O-sulphate, sodium salt | US11034717, Compound 5
TypeSmall organic molecule
Emp. Form.C26H45NaO7S
Mol. Mass.524.686
SMILESCC[C@H]1[C@@H](O)C2C3CC[C@H]([C@H](C)CCCOS(=O)(=O)O[Na])[C@@]3(C)C[C@H](O)C2[C@@]2(C)CC[C@@H](O)C[C@@H]12 |r|
Structure
n/a