Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataEC50: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataEC50: 1nMAssay Description:Enzyme potency (PDK1 EC50)was determined using recombinant, purified full-length human PDK1 enzyme and AKT-Thr-308-tide as substrate.More data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataEC50: 1nMAssay Description:Enzyme potency (PDK1 EC50)was determined using recombinant, purified full-length human PDK1 enzyme and AKT-Thr-308-tide as substrate.More data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKd: 1.70nMAssay Description:Binding constant for full-length PDPK1More data for this Ligand-Target Pair
Affinity DataKd: 1.70nMAssay Description:Binding constant for PDPK1 kinase domainMore data for this Ligand-Target Pair
Affinity DataKd: 1.70nMAssay Description:Kinase inhibitors are a new class of therapeutics with a propensity to inhibit multiple targets. The biological consequences of multi-kinase activity...More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5Assay Description:Recombinant human PDK1 enzyme (aa 52-556) linked at its N-terminal end to His6 is isolated from baculovirus-infected insect cells. Purified enzyme ma...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:The activity of the compounds according to the invention on the kinase PDK1 which inhibits the signal transduction pathway is determined in an in vit...More data for this Ligand-Target Pair




















3D Structure (crystal)



























