Compile Data Set for Download or QSAR
Report error Found 105 of affinity data for UniProtKB/TrEMBL: P32301
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50604669BDBM50604669(CHEMBL5208485)
Affinity DataEC50:  0.00800nMAssay Description:Positive allosteric modulator activity at GLP-1R in rat INS1 beta-cells assessed potentiation of GLP-1(7-36)NH2 induced insulin secretion incubated f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/25/2023
Entry Details
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393580BDBM50393580(CHEMBL2158410)
Affinity DataEC50:  0.0900nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557261BDBM50557261(CHEMBL4749279)
Affinity DataEC50:  0.120nMAssay Description:Agonist activity at rat GLP-1R expressed in HEK293 cells assessed as stimulation of cAMP accumulation by FRET assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50241203BDBM50241203(exenatide | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGSPPP...)
Affinity DataIC50: 0.140nMAssay Description:Displacement of [125I]exendin-4 from GLP1 receptor in rat RINm5F cells after 2 hrs by gamma countingMore data for this Ligand-Target Pair
In Depth
Date in BDB:
11/18/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231948BDBM50231948(CHEMBL4066463)
Affinity DataEC50:  0.25nMAssay Description:Agonist activity at GLP1R in rat INS-1 cells assessed as increase in glucose-stimulated insulin secretion after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50604669BDBM50604669(CHEMBL5208485)
Affinity DataEC50:  0.25nMAssay Description:Positive allosteric modulator activity at GLP-1R in rat INS1 beta-cells assessed potentiation of GLP-1(7-36)NH2 induced insulin secretion incubated f...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/25/2023
Entry Details
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50314037BDBM50314037(CHEMBL1092704)
Affinity DataIC50: 0.370nMAssay Description:Displacement of [125I]exendin-4 from GLP1 receptor in rat RINm5F cells after 2 hrs by gamma countingMore data for this Ligand-Target Pair
In Depth
Date in BDB:
11/18/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50557264BDBM50557264(CHEMBL4751466)
Affinity DataEC50:  0.480nMAssay Description:Agonist activity at rat GLP-1R expressed in HEK293 cells assessed as stimulation of cAMP accumulation by FRET assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
3/26/2022
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50314036BDBM50314036(CHEMBL1092373)
Affinity DataIC50: 0.480nMAssay Description:Displacement of [125I]exendin-4 from GLP1 receptor in rat RINm5F cells after 2 hrs by gamma countingMore data for this Ligand-Target Pair
In Depth
Date in BDB:
11/18/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50314039BDBM50314039(CHEMBL1092706)
Affinity DataIC50: 0.550nMAssay Description:Displacement of [125I]exendin-4 from GLP1 receptor in rat RINm5F cells after 2 hrs by gamma countingMore data for this Ligand-Target Pair
In Depth
Date in BDB:
11/18/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50314041BDBM50314041(CHEMBL1092708)
Affinity DataIC50: 0.580nMAssay Description:Displacement of [125I]exendin-4 from GLP1 receptor in rat RINm5F cells after 2 hrs by gamma countingMore data for this Ligand-Target Pair
In Depth
Date in BDB:
11/18/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231943BDBM50231943(CHEMBL4093072)
Affinity DataEC50:  0.900nMAssay Description:Agonist activity at GLP1R in rat INS-1 cells assessed as increase in glucose-stimulated insulin secretion after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50261506BDBM50261506(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-NH2 | CHEMBL499930)
Affinity DataEC50:  0.900nMAssay Description:Agonist activity at GLP1R in rat INS-1 cells assessed as increase in glucose-stimulated insulin secretion after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50314038BDBM50314038(CHEMBL1092705)
Affinity DataIC50: 3.18nMAssay Description:Displacement of [125I]exendin-4 from GLP1 receptor in rat RINm5F cells after 2 hrs by gamma countingMore data for this Ligand-Target Pair
In Depth
Date in BDB:
11/18/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50604669BDBM50604669(CHEMBL5208485)
Affinity DataIC50: 6.30nMAssay Description:Positive allosteric modulator activity at GLP-1R in rat INS1 beta-cells assessed potentiation of GLP-1(7-36)NH2 induced insulin secretion at 0.1 nM i...More data for this Ligand-Target Pair
In Depth
Date in BDB:
6/25/2023
Entry Details
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50314040BDBM50314040(CHEMBL1092707)
Affinity DataIC50: 10.1nMAssay Description:Displacement of [125I]exendin-4 from GLP1 receptor in rat RINm5F cells after 2 hrs by gamma countingMore data for this Ligand-Target Pair
In Depth
Date in BDB:
11/18/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231901BDBM50231901(CHEMBL4088708)
Affinity DataEC50:  16nMAssay Description:Agonist activity at GLP1R in rat INS-1 cells assessed as increase in glucose-stimulated insulin secretion after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231886BDBM50231886(CHEMBL4070761)
Affinity DataEC50:  50nMAssay Description:Agonist activity at GLP1R in rat INS-1 cells assessed as increase in glucose-stimulated insulin secretion after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50314042BDBM50314042(CHEMBL1092709)
Affinity DataIC50: 72.0nMAssay Description:Displacement of [125I]exendin-4 from GLP1 receptor in rat RINm5F cells after 2 hrs by gamma countingMore data for this Ligand-Target Pair
In Depth
Date in BDB:
11/18/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393574BDBM50393574(CHEMBL2158422)
Affinity DataEC50:  118nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50231963BDBM50231963(CHEMBL4104146)
Affinity DataEC50:  130nMAssay Description:Agonist activity at GLP1R in rat INS-1 cells assessed as increase in glucose-stimulated insulin secretion after 1 hr by HTRF assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/7/2019
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393576BDBM50393576(CHEMBL2158419)
Affinity DataEC50:  148nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393572BDBM50393572(CHEMBL2158488)
Affinity DataEC50:  203nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMedPDB3D3D Structure (crystal)
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50260245BDBM50260245(1,3-bis(4-(cyclopentanecarboxamido)benzamido)-2,4-...)
Affinity DataKi:  287nMAssay Description:Displacement of [125I]GLP1 from rat GLP1 receptor expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50260245BDBM50260245(1,3-bis(4-(cyclopentanecarboxamido)benzamido)-2,4-...)
Affinity DataIC50: 300nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393572BDBM50393572(CHEMBL2158488)
Affinity DataIC50: 300nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMedPDB3D3D Structure (crystal)
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393590BDBM50393590(CHEMBL2158404)
Affinity DataEC50:  326nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50260246BDBM50260246(1,3-bis(4-(tert-butoxycarbonyl)benzamido)-2,4-bis(...)
Affinity DataEC50:  370nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50260246BDBM50260246(1,3-bis(4-(tert-butoxycarbonyl)benzamido)-2,4-bis(...)
Affinity DataEC50:  371nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393571BDBM50393571(CHEMBL2158489)
Affinity DataIC50: 500nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50260246BDBM50260246(1,3-bis(4-(tert-butoxycarbonyl)benzamido)-2,4-bis(...)
Affinity DataIC50: 600nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50260246BDBM50260246(1,3-bis(4-(tert-butoxycarbonyl)benzamido)-2,4-bis(...)
Affinity DataIC50: 600nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50260245BDBM50260245(1,3-bis(4-(cyclopentanecarboxamido)benzamido)-2,4-...)
Affinity DataEC50:  657nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393573BDBM50393573(CHEMBL2158423)
Affinity DataEC50:  696nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393575BDBM50393575(CHEMBL2158420)
Affinity DataEC50:  749nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393601BDBM50393601(CHEMBL2158498)
Affinity DataIC50: 900nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393580BDBM50393580(CHEMBL2158410)
Affinity DataIC50: 1.00E+3nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393606BDBM50393606(CHEMBL2158421)
Affinity DataIC50: 1.00E+3nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50260245BDBM50260245(1,3-bis(4-(cyclopentanecarboxamido)benzamido)-2,4-...)
Affinity DataEC50:  1.08E+3nMAssay Description:Agonist activity at rat GLP1 receptor expressed in HEK293 cells assessed as cAMP releaseMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393571BDBM50393571(CHEMBL2158489)
Affinity DataEC50:  1.11E+3nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393576BDBM50393576(CHEMBL2158419)
Affinity DataIC50: 1.20E+3nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393575BDBM50393575(CHEMBL2158420)
Affinity DataIC50: 1.20E+3nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50260246BDBM50260246(1,3-bis(4-(tert-butoxycarbonyl)benzamido)-2,4-bis(...)
Affinity DataIC50: 1.30E+3nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393586BDBM50393586(CHEMBL2158409)
Affinity DataEC50:  1.38E+3nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393569BDBM50393569(CHEMBL2158494)
Affinity DataIC50: 1.40E+3nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50260246BDBM50260246(1,3-bis(4-(tert-butoxycarbonyl)benzamido)-2,4-bis(...)
Affinity DataKi:  1.47E+3nMAssay Description:Displacement of [125I]GLP1 from rat GLP1 receptor expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
1/11/2010
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393603BDBM50393603(CHEMBL2158491)
Affinity DataIC50: 1.90E+3nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393568BDBM50393568(CHEMBL2158495)
Affinity DataEC50:  2.13E+3nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393585BDBM50393585(CHEMBL2158311)
Affinity DataEC50:  2.15E+3nMAssay Description:Agonist activity at rat GLP1R expressed in HEK293 cells assessed as stimulation of cAMP levels incubated for 6 hrs by multiple response element/cAMP ...More data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
TargetGlucagon-like peptide 1 receptor(Rat)
Hospital Regional Universitario

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 50393574BDBM50393574(CHEMBL2158422)
Affinity DataIC50: 2.31E+3nMAssay Description:Inhibition of [125I]GLP1 (7-36) amide binding to rat GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In Depth
Date in BDB:
5/17/2013
Entry Details Article
PubMed
Displayed 1 to 50 (of 105 total ) | Next | Last >>
Jump to: