BDBM194639 US9206139, 2

SMILES CC[C@H](Cc1ccc(cc1)C(F)(F)F)C(=O)NC[C@]1(NC(=O)NC1=O)C1CC1

InChI Key InChIKey=XTJBTJMEXZEGIF-UHFFFAOYSA-N

Data  22 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 22 hits for monomerid = 194639   

LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 1nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/30/2019
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 2nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/30/2019
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 2nMpH: 7.5 T: 2°CAssay Description:The compounds of the present invention can be evaluated by using an aggrecanase ADAMTS-4 and ADAMTS-5 AlphaScreen assay (Miller J. A., et al. Anal. B...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

TargetNeutrophil collagenase(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 5.10nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 20nMAssay Description:The AlphaScreen Assay is modified to include the testing of inhibitors against ADAMTS-5 in the presence of 50% Lewis rat plasma in order to determine...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 20nMAssay Description:Inhibition of human ADAMTS5 using [protein fragment, 43 aa] peptide as substrate after 3 hrs in the presence of 50% Lewis rat plasm...More data for this Ligand-Target Pair
In Depth
Date in BDB:
8/30/2019
Entry Details Article
PubMed
TargetMacrophage metalloelastase(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 26nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

TargetMacrophage metalloelastase(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 26nMAssay Description:Inhibition of human MMP12 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/30/2019
Entry Details Article
PubMed
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 326nMAssay Description:The AlphaScreen Assay is modified to include the testing of inhibitors against ADAMTS-5 in the presence of 50% Lewis rat plasma in order to determine...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

TargetMatrix metalloproteinase-9(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 439nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

Target72 kDa type IV collagenase(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 704nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

TargetInterstitial collagenase(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 897nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

Target72 kDa type IV collagenase(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 3.00E+3nMAssay Description:Inhibition of human MMP2 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/30/2019
Entry Details Article
PubMed
TargetCollagenase 3(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 4.19E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

TargetCollagenase 3(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 4.20E+3nMAssay Description:Inhibition of human MMP13 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/30/2019
Entry Details Article
PubMed
TargetMatrix metalloproteinase-14(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 7.99E+3nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

TargetMatrix metalloproteinase-14(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 8.00E+3nMAssay Description:Inhibition of human MMP14 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/30/2019
Entry Details Article
PubMed
TargetStromelysin-1(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 1.50E+4nMAssay Description:Inhibition of human MMP3 using Mca-PQGL-(3-[2, 4-dinitrophenyl]-L-2, 3-diaminopropionyl)-AR-OH as substrate after 2 to 4 hrs by fluorescence assayMore data for this Ligand-Target Pair
In Depth
Date in BDB:
8/30/2019
Entry Details Article
PubMed
TargetStromelysin-1(Human)
Eli Lilly

Curated by ChEMBL
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 1.53E+4nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent

TargetMatrilysin(Human)
Eli Lilly

US Patent
LigandChemical structure of BindingDB Monomer ID 194639BDBM194639(US9206139, 2)
Affinity DataIC50: 1.00E+5nMpH: 7.5Assay Description:A continuous assay is used in which the substrate is a synthetic peptide containing a fluorescent group (7-methoxycoumarin, Mca), which is quenched b...More data for this Ligand-Target Pair
In Depth
Date in BDB:
10/3/2016
Entry Details
US Patent