BDBM50441592 CHEMBL2437170

SMILES Clc1ccc(OCC(=O)NNC(=S)NCc2ccccc2-c2ccccc2)cc1

InChI Key InChIKey=FCDMQPRDNBHPGY-UHFFFAOYSA-N

Data  2 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 2 hits for monomerid = 50441592   

TargetA disintegrin and metalloproteinase with thrombospondin motifs 4(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441592(CHEMBL2437170)
Affinity DataIC50:  2.90E+3nMAssay Description:Inhibition of human recombinant ADAMTS-4 using QTVTWPDMELPLPRNITEGEARGSVIL-TVKPIFEVSPSPL(biotinyl)K as substrate incubated for 10 mins prior to subst...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetA disintegrin and metalloproteinase with thrombospondin motifs 5(Homo sapiens (Human))
University Of Lille

Curated by ChEMBL
LigandPNGBDBM50441592(CHEMBL2437170)
Affinity DataIC50:  490nMAssay Description:Inhibition of human recombinant ADAMTS-5 using ARGSVILTV-KPIFEVSPSPL(biotinyl)K as substrate incubated 10 mins prior to substrate addition measured a...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed