BDBM50602439 CHEMBL5172426::US11919896, Compound 1-11::US12419873, Compound 1-11
SMILES O=C(Nc1nc2cccc(C3CCC4(CN(C4)C(=O)C4(CC4)C#N)CC3)n2n1)C1CC1
InChI Key InChIKey=RMQNBYVKJXQSLH-UHFFFAOYSA-N
Data 12 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 12 hits for monomerid = 50602439
Affinity DataIC50: 15nMAssay Description:JAK1:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Affinity DataIC50: 15nMAssay Description:Inhibition of recombinant human JAK1 using MGEEPLYWSFPAKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Affinity DataIC50: 15nMAssay Description:JAK1 (h) was incubated with 20 mm Tris/HCl pH7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mm magnesium acetate and [γ-33P]-ATP (activity and concentr...More data for this Ligand-Target Pair
Affinity DataIC50: 18nMAssay Description:TYK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Affinity DataIC50: 18nMAssay Description:Inhibition of recombinant human TYK2 using GGMEDIYFEFMGGKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based...More data for this Ligand-Target Pair
Affinity DataIC50: 18nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and concentrati...More data for this Ligand-Target Pair
Affinity DataIC50: 198nMAssay Description:JAK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM magnesium acetate and [γ-33P]-ATP (a...More data for this Ligand-Target Pair
Affinity DataIC50: 198nMAssay Description:JAK2:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Affinity DataIC50: 198nMAssay Description:Inhibition of recombinant human JAK2 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 40 mins in presence of Mg/ATP mixture b...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+4nMAssay Description:Inhibition of recombinant human JAK3 using GGEEEEYFELVKKKK as substrate incubated for 40 mins in presence of Mg/ATP mixture by [gamma p33]-ATP based ...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+4nMAssay Description:JAK3:Dilution of JAK2, JAK3 and TYK2: 20 mM 3-(N-morpholine)propanesulfonic acid (MOPS), 1 mM EDTA, 0.01% Brij-35.5% glycerol, 0.1% β-mercaptoet...More data for this Ligand-Target Pair
Affinity DataIC50: 1.00E+4nMAssay Description:JAK3 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and concentratio...More data for this Ligand-Target Pair
