BDBM712433 US20250011332, Compound 8
SMILES Cn1ccc(-c2cn3nccc3c(-c3cnn(C4(CC#N)CC5C(C#N)C5C4)c3)n2)n1
InChI Key InChIKey=ZGZFDONGLUANIS-UHFFFAOYSA-N
Data 4 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 4 hits for monomerid = 712433
Affinity DataIC50: 1.13nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Affinity DataIC50: 6.43nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Affinity DataIC50: 13.7nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Affinity DataIC50: 22.8nMAssay Description:JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK (SEQ ID NO: 3), 10 mM magnesium acetate, and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
