BDBM712444 US20250011332, Compound 20

SMILES N#CC[C@]1(n2cc(-c3nc(-c4cc(N)[nH]n4)cn4nccc34)cn2)CC2(C[C@H](C#N)C2)C1

InChI Key InChIKey=NRHRWKIGNQTVOW-UHFFFAOYSA-N

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 4 hits for monomerid = 712444   

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Soter Biopharma

US Patent
LigandChemical structure of BindingDB Monomer ID 712444BDBM712444(US20250011332, Compound 20)
Affinity DataIC50: 1nMAssay Description:TYK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK (SEQ ID NO: 4), 10 mM magnesium acetate, and [γ-33P]-ATP (activity ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Soter Biopharma

US Patent
LigandChemical structure of BindingDB Monomer ID 712444BDBM712444(US20250011332, Compound 20)
Affinity DataIC50: 5nMAssay Description:JAK2(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC (SEQ ID NO: 2), 10 mM magnesium acetate, and...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK1(Human)
Soter Biopharma

US Patent
LigandChemical structure of BindingDB Monomer ID 712444BDBM712444(US20250011332, Compound 20)
Affinity DataIC50: 14nMAssay Description:JAK1(h) was incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK (SEQ ID NO: 1), 10 mM magnesium acetate and [γ-33P]-ATP (activi...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Soter Biopharma

US Patent
LigandChemical structure of BindingDB Monomer ID 712444BDBM712444(US20250011332, Compound 20)
Affinity DataIC50: 480nMAssay Description:JAK3(h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK (SEQ ID NO: 3), 10 mM magnesium acetate, and [γ-33P]-ATP (activity a...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
5/22/2025
Entry Details
US Patent