BDBM771878 US12419873, Compound 1-7
SMILES O=C(Nc1nc2cccc(C3CCC4(CC3)CN(C(=O)C3CC3)C4)n2n1)C1CC1
InChI Key
Data 4 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 4 hits for monomerid = 771878
Affinity DataIC50: 6nMAssay Description:JAK1 (h) was incubated with 20 mm Tris/HCl pH7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mm magnesium acetate and [γ-33P]-ATP (activity and concentr...More data for this Ligand-Target Pair
Affinity DataIC50: 38nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and concentrati...More data for this Ligand-Target Pair
Affinity DataIC50: 60nMAssay Description:JAK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (a...More data for this Ligand-Target Pair
Affinity DataIC50: 3.83E+3nMAssay Description:JAK3 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and concentratio...More data for this Ligand-Target Pair
