BDBM771878 US12419873, Compound 1-7

SMILES O=C(Nc1nc2cccc(C3CCC4(CC3)CN(C(=O)C3CC3)C4)n2n1)C1CC1

InChI Key

Data  4 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 4 hits for monomerid = 771878   

TargetTyrosine-protein kinase JAK1(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 771878BDBM771878(US12419873, Compound 1-7)
Affinity DataIC50: 6nMAssay Description:JAK1 (h) was incubated with 20 mm Tris/HCl pH7.5, 0.2 mM EDTA, 500 μM MGEEPLYWSFPAKKK, 10 mm magnesium acetate and [γ-33P]-ATP (activity and concentr...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 771878BDBM771878(US12419873, Compound 1-7)
Affinity DataIC50: 38nMAssay Description:TYK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and concentrati...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetTyrosine-protein kinase JAK2(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 771878BDBM771878(US12419873, Compound 1-7)
Affinity DataIC50: 60nMAssay Description:JAK2 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM magnesium acetate and [γ-33P]-ATP (a...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent

TargetTyrosine-protein kinase JAK3(Human)
Zhuhai United Laboratories Co.

US Patent
LigandChemical structure of BindingDB Monomer ID 771878BDBM771878(US12419873, Compound 1-7)
Affinity DataIC50: 3.83E+3nMAssay Description:JAK3 (h) was incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 500 μM GGEEEEYFELVKKKK, 10 mM magnesium acetate and [γ-33P]-ATP (activity and concentratio...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In Depth
Date in BDB:
1/6/2026
Entry Details
US Patent