BDBM50091652 CHEMBL269503::PYY::PYY, rat::Peptide YY(PYY)(YPAKPEAPGEDASPEELSRYYASLAHYLNLVTRQRY)

SMILES CC(C)C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)Cc1ccc(O)cc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(O)=O

InChI Key InChIKey=IXMRLEGHWROJAA-HDTKZREISA-N

Data  9 KI  3 IC50

  Tab Delimited (TSV)   2D SDfile   Computed 3D by Vconf -m prep SDfile
Find this compound or compounds like it in BindingDB:
   Substructure
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 12 hits for monomerid = 50091652   

TargetNeuropeptide Y receptor type 1(Mouse)
Merck Research Laboratories

Curated by PDSP Ki Database
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
Affinity DataKi:  0.350nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
Affinity DataKi:  0.480nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNeuropeptide Y receptor type 2(Mouse)
Merck Research Laboratories

Curated by PDSP Ki Database
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
Affinity DataKi:  0.700nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
In DepthDetails ArticlePubMed
TargetNeuropeptide Y receptor type 5(Human)
Meiji Seika Kaisha

Curated by PDSP Ki Database
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
In DepthDetails ArticlePubMed
TargetNeuropeptide Y receptor type 5(Human)
Meiji Seika Kaisha

Curated by PDSP Ki Database
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
Affinity DataKi:  1.30nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNeuropeptide Y receptor type 1(Human)
Meiji Seika Kaisha

Curated by PDSP Ki Database
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
In DepthDetails ArticlePubMed
TargetNeuropeptide Y receptor type 2(Human)
Meiji Seika Kaisha

Curated by PDSP Ki Database
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
Affinity DataKi:  2.10nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNeuropeptide Y receptor type 5(Mouse)
Merck Research Laboratories

Curated by PDSP Ki Database
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
Affinity DataKi:  5.5nMMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNeuropeptide Y receptor type 1(Human)
Meiji Seika Kaisha

Curated by PDSP Ki Database
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
Affinity DataIC50:  0.0200nMAssay Description:Affinity against Neuropeptide Y receptor Y1 in SK-N-MC cell lineMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNeuropeptide Y receptor type 2(Rat)
University of Cincinnati Medical Center

Curated by ChEMBL
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
Affinity DataIC50:  0.140nMAssay Description:Antisecretory potency, affinity for intestinal PYY of rat jejunum by using short circuit current (SCC) method.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetNeuropeptide Y receptor type 2(Human)
Meiji Seika Kaisha

Curated by PDSP Ki Database
LigandPNGBDBM50091652(CHEMBL269503 | PYY | PYY, rat | Peptide YY(PYY)(YP...)
Affinity DataIC50:  0.0700nMAssay Description:Affinity against Neuropeptide Y receptor Y2 in SK-N-BE2 cell lineMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed