BDBM394583 2-(6-amino-5-phenylpyridazin-3-yl)phenol::US10308614, Example 186
SMILES Nc1nnc(cc1-c1ccccc1)-c1ccccc1O
InChI Key InChIKey=SDAWPVIWTVUTCC-UHFFFAOYSA-N
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 22 hits for monomerid = 394583
Affinity DataIC50: 8.90nMAssay Description:Inhibition of PBRM1 bromodomain 5 (unknown origin) by TR-FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 8.90nMAssay Description:Histidine-Flag-PB1-BD5 Bromodomain645-766 (S645-D766; Swiss Prot Q86U86; mhhhhhhasdykddddkgslvprgsSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRLSAI FLRLPSRSELP...More data for this Ligand-Target Pair
Affinity DataIC50: 30nMAssay Description:Inhibition of His-tagged SMARCA4 (unknown origin) (1448 to 1575 residues) using biotinylated ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAPGG...More data for this Ligand-Target Pair
TargetProbable global transcription activator SNF2L2(Human)
Constellation, A Morphosys
Curated by ChEMBL
Constellation, A Morphosys
Curated by ChEMBL
Affinity DataIC50: 37nMAssay Description:Inhibition of SMARCA2 (unknown origin) by TR-FRET assayMore data for this Ligand-Target Pair
TargetIsoform Short of Probable global transcription activator SNF2L2 (Short) 377-1486](Human)
Genentech
US Patent
Genentech
US Patent
Affinity DataIC50: 37.3nMAssay Description:Histidine epitope tagged BRM (Isoform 2) Bromodomain1377-1486 (S1377-Q1486; Swiss Prot P51531-2; mhhhhhhgslvprgsSPNPPKLTKQMNAIIDTVINYKDSSGRQLSEVFIQLP...More data for this Ligand-Target Pair
Affinity DataIC50: 38.7nMAssay Description:His-BRG1 (A1448-S1575; Swiss Prot P51532; mhhhhhhgslvprgsAEKLSPNPP NLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNH KYRSLNDLEKDVMLLCQNAQ...More data for this Ligand-Target Pair
Affinity DataKd: 40nMAssay Description:Binding affinity to PBRM1 bromodomain 5 (unknown origin) assessed as dissociation constant by BROMOscan LeadHunter assayMore data for this Ligand-Target Pair
TargetProbable global transcription activator SNF2L2(Human)
Constellation, A Morphosys
Curated by ChEMBL
Constellation, A Morphosys
Curated by ChEMBL
Affinity DataKd: 40nMAssay Description:Binding affinity to SMARCA2 (unknown origin) assessed as dissociation constant by BROMOscan LeadHunter assayMore data for this Ligand-Target Pair
TargetProbable global transcription activator SNF2L2(Human)
Constellation, A Morphosys
Curated by ChEMBL
Constellation, A Morphosys
Curated by ChEMBL
Affinity DataKd: 61nMAssay Description:Binding affinity to human MHHHHHHGSLVPRGS-tagged SMARAC2 isoform B (S1377 to Q1486 residues) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
Affinity DataKd: 63nMAssay Description:Binding affinity to His6/FLAG-tagged SMARCA4 (unknown origin) by isothermal titration calorimetric assayMore data for this Ligand-Target Pair
Affinity DataKd: 69nMAssay Description:Binding affinity to human PBRM1 bromodomain 5 (S645 to D766 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
Affinity DataKd: 70nMAssay Description:Binding affinity to SMARCA4 (unknown origin) assessed as dissociation constant by BROMOscan LeadHunter assayMore data for this Ligand-Target Pair
TargetProbable global transcription activator SNF2L2(Human)
Constellation, A Morphosys
Curated by ChEMBL
Constellation, A Morphosys
Curated by ChEMBL
Affinity DataKd: 71nMAssay Description:Binding affinity to human SMARCA2 (S1337 to Q1486 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
Affinity DataKd: 86nMAssay Description:Binding affinity to human SMARCA4 (A1448 to S1575 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
Affinity DataKd: 300nMAssay Description:Binding affinity to PBRM1 bromodomain 2 (unknown origin) assessed as dissociation constant by BROMOscan LeadHunter assayMore data for this Ligand-Target Pair
TargetProbable global transcription activator SNF2L2(Human)
Constellation, A Morphosys
Curated by ChEMBL
Constellation, A Morphosys
Curated by ChEMBL
Affinity DataEC50: 300nMAssay Description:Inhibition of SMARAC2 isoform B (unknown origin) expressed in U2OS cells co-expressed in NLS-ZsGreen incubated for 1 hrs by cellular target engagemen...More data for this Ligand-Target Pair
Affinity DataKd: 550nMAssay Description:Binding affinity to human PBRM1 bromodomain 2 (S178 to E291 residues) expressed in bacterial expression system by bromoscan assayMore data for this Ligand-Target Pair
TargetProbable global transcription activator SNF2L2(Human)
Constellation, A Morphosys
Curated by ChEMBL
Constellation, A Morphosys
Curated by ChEMBL
Affinity DataKd: 1.10E+3nMAssay Description:Binding affinity to human MHHHHHHGSLVPRGS-tagged SMARAC2 isoform B L1412P/P1413V/S1414N mutant (S1377 to Q1486 residues) by isothermal titration calo...More data for this Ligand-Target Pair
Affinity DataIC50: 4.40E+3nMAssay Description:Binding affinity to PXR (unknown origin) by Lanthascreen TR-FRET assayMore data for this Ligand-Target Pair
Affinity DataEC50: >2.00E+4nMAssay Description:Binding affinity to LXRbeta (unknown origin) by Lanthascreen TR-FRET assayMore data for this Ligand-Target Pair
Affinity DataEC50: >2.00E+4nMAssay Description:Binding affinity to LXR alpha (unknown origin) by Lanthascreen TR-FRET assayMore data for this Ligand-Target Pair
Affinity DataIC50: 2.70E+4nMAssay Description:Inhibition of BRD4 bromodomain 1 (unknown origin) by TR-FRET assayMore data for this Ligand-Target Pair
